HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0722COG2012KOG3218arCOG04258DNA-directed RNA polymerase subunit H RpoH/RPB5DNA-directed RNA polymerase subunit H

HOG Organism Gene ID Name Annotation
cHOG0722 nrc1 VNG2668 rpoH DNA-directed RNA polymerase subunit H
cHOG0722 hmu HMUK0516 Hmuk_0516 RNA polymerase Rpb5( EC:2.7.7.6 )
cHOG0722 hma RRNAC2432 rpoH DNA-directed RNA polymerase subunit H
cHOG0722 hwa HQ3397A rpoH DNA-directed RNA polymerase subunit H
cHOG0722 hla HLAC0108 Hlac_108 RNA polymerase Rpb5
cHOG0722 hbo HBOR28250 Hbor_28250 DNA-directed RNA polymerase, subunit H( EC:2.7.7.6 )
cHOG0722 hut HUTA0785 Huta_0785 RNA polymerase Rpb5
cHOG0722 hvo HVO_0346 HVO_0346 RNA polymerase Rpb5 C-terminal domain
cHOG0722 nph NP0108A rpoH DNA-directed RNA polymerase subunit H
cHOG0722 hhi 2863 rpoH DNA-directed RNA polymerase subunit H
MUSCLE (3.6) multiple sequence alignment


3397|gene|hwa       MVDVNQHTLVPEHTLVDEDDIEAILTEYDIRRADLPKIQRRDPALPDNAEPGDVVKIVRD
2668|gene|nrc1      MVDVSQHELVPEHTVLDEETLDGVLADYDIDRTELPKIKYKDPALPDNAEIGDVVEIVRD
12432|gene|hma      MVDVSQHDLVPDHSVVDEDDLEAVLTEYEIKKTDLPKIKRTDKALPDDAEVGDVVRIVRD
2863|gene|hhi       MVDVSQHDLVPDHSVVDEDDLEAVLTEYEIKKTDLPKIKRTDKALPDDAEVGDVVRIVRD
28250|gene|hbo      MVDVSQHKLVPEHILLEEEEVEEMLDEYDVKRTNLPKIKRTDPAAPDDAEAGDVIKIVRD
108|gene|hla        MVDVSQHELVPDHVLLEAEEVDEVLAEYDVKRTNLPKIKRTDPALPDEAEVGDVVKIVRN
108|gene|nph        MVDVSQHNMVPEHTVLDREEVEDVLAEYDIKRTDLPKIQRRDAALPDDAEPGNVVKIVRD
785|gene|hut        MVDVSQHELVPEHTILDDGELEEVLGEYDIKRTDLPKIKRADPALPDEAEVGDVIKIARD
                    ****.** :**:* :::   :: :* :*:: .::****:  * * **:** *:*: *.*:

3397|gene|hwa       SRTTDRAVSYRLVIE
2668|gene|nrc1      SRTTDEAVVYRLVIE
12432|gene|hma      SRTTDEAVVYRLVVE
2863|gene|hhi       SRTTDEAVVYRLVVE
28250|gene|hbo      SRTTDKAVTYRLVIE
108|gene|hla        SRTTEEAVVYRLVVS
108|gene|nph        SRTTDEAVVYRLVVE
785|gene|hut        SRTTDTAVVYRLVVE
                    ****: ** ****:.