HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0072COG1430arCOG03116Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0072 nrc1 VNG0121 vng121 no entry
cHOG0072 hmu HMUK0419 Hmuk_0419 protein of unknown function DUF192
cHOG0072 hma RRNAC2315 hypothetical protein
cHOG0072 hwa HQ1140A hypothetical protein
cHOG0072 hwa HQ1203A hypothetical protein
cHOG0072 hla HLAC2526 Hlac_2526 protein of unknown function DUF192
cHOG0072 hla HLAC1384 Hlac_1384 protein of unknown function DUF192
cHOG0072 hbo HBOR27220 Hbor_27220 uncharacterized conserved protein
cHOG0072 hut HUTA1832 Huta_1832 protein of unknown function DUF192
cHOG0072 hvo HVO_0504 HVO_0504 Uncharacterized ACR COG1430
cHOG0072 nph NP0004A hypothetical protein
cHOG0072 hhi 2771 HAH_2771 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


121|hp|nrc1        ----------MRWTVLVVAAFVVG------AGCGGPPMAAQDPP----------------
2526|gene|hla      --------MNRRLLAIASALGAIA---LLLVAAIAANPA---------------------
4|hp|nph           MDTRRVVGYAVAAVALAAAAVLLAFSTGLIAPFLGDGYDPDAYDPDDSY-----------
1203|hp|hwa        MQSNMPLPSSRRQCLQYIAVGVTG---AGFAGCVGDSPAQSETTTEDSDIT---------
1384|gene|hla      --------MRRRGVLAAIGVASIG---GL-AGCGGSAPTEDDGGEDGEGGRNDTGTDDLP
1140|hp|hwa        ----MNRTLFLRAVIVAIGVLVVG--VIVITVIPGIGPT---------------------
1832|hp|hut        MDYSRLVDVLVVVLLALATVLSLT------------GPTSPLAPI---------------
27220|hp|hbo       -----MTALRDRLGPVILAVFIVA---SVAAVVVAFNPTVL-------------------
12315|hp|hma       MQRPAVVVLGLVGLLVAAAVVLQT---GLWVEVLGTGEYEEGTVTVREGSDAVTTTATQP
2771|hp|hhi        MQRPAVIVLGLVGLLVAAAVVLQT---GLWIEVLGTGEYEEGTVTVREASDAVTPTATQP
                                                                               

121|hp|nrc1        -----STPESGDAPMVTVVDADTGVEHGSVAVAVAATRGERYTGLSTRESLSADEGMLFV
2526|gene|hla      -----LLIAGYDTTTVEAVDGETGDSLATVETRVADGFAKQYVGLSETDELADDEGMLFV
4|hp|nph           -----GGDTDYEHTTVTVVDGETGAELGAVDAAIADTFNKRYLGLSATDGLPEDRGMFFV
1203|hp|hwa        -----QVHAEYETTDVRIESAE-GDRLGTVTAAIADTGELRYLGLSDTENLPENRGMLFI
1384|gene|hla      TDWPSGTYADYDAATVTVRSPE-DDDLGAVRAAIADTREKRYLGLSDATSLPENAGMLFV
1140|hp|hwa        --------GEYDSETVKITDNKTGNQLERVSVRIADTPQKRYTGLSNTESLAEDEGMLFI
1832|hp|hut        -----LSPLSYEEPTISISDEN-GTELATVDVRVADTDRERYIGLSRTESLSDGEGMLFV
27220|hp|hbo       -----PGGDQYNRTTVSLISD--GERVAEVNVRVADTYEKRYTGLSATESLGTNEGMLFV
12315|hp|hma       -----STDASTPGTTVAVREKNAGEPLGTVEVRIAQTFDQRYVGLSNTESLGPNEGMLFV
2771|hp|hhi        -----STDTSMPETTIAAREQEAGEPLGTVEVRIAQTFDQRYVGLSKTESLGPDEGMLFV
                                  :   .   .     * . :*     .* ***    *  . **:*:

121|hp|nrc1        HERA-GSRAYVMRSMAFPIDIIYVGADRNITSIHHATVP---DGDGPLTRYEGHGKWVLE
2526|gene|hla      HDET-GKHAYVMRGMSFGLDIVFVAPNGTVTEIHEAA-----PDSRPYTRYAGTGRYVLE
4|hp|nph           HDSP-DDYTYVMRDMSFGIDIVYADADGTITAVHEAPAPGP-NEDGDDHEYPGYGQYVLE
1203|hp|hwa        YDSS-GNRTFVMREMDFGIDIIYADSEGVITSIHHADAPGP-DEDGNNQQYSGQGQYVLE
1384|gene|hla      FSEPRDSLRFVMREMDFGIDIIYADAEGTITRIHNAPEPGP-NEDGSEQRYPGSGQYVLE
1140|hp|hwa        HDSE-DRYGYVMRDMSFPIDIIFIDATGTITRIYHAKVPTD-TTTDELNRYSGRGRYVLE
1832|hp|hut        HAES-GTYPYVMRNMAFPIDIVFIDTNGTITTIHHAELPA--DPSDPQQQYWGEGQYVLE
27220|hp|hbo       HDSE-GEYSYVMRDMAFPLDIVFIDADGTITAIHHAELPPEGTPDGGLKHYTGTGKYVLE
12315|hp|hma       HDEA-GQYTYVMRNMSFPLDIIFIDANGTITTIHHAPLPPEGTSESGLTGYAGRGKYVLE
2771|hp|hhi        HDEE-GQHTYVMRNMSFPIDIIFIDANGTITAIHHAPLPPEGTSESGLTGYEGRGKYVLE
                   .    .   :*** * * :**::  .   :* :: *              * * *.:***

121|hp|nrc1        VSLNWTAAHNVSVGDRVRIPAAGE-
2526|gene|hla      APRGWSERNGVGPGDRLVFEVD---
4|hp|nph           VNKGWMADRGAGVGDKLRFEL----
1203|hp|hwa        INKDWTTARDIEAGDVLVSEAIA--
1384|gene|hla      VPYKWTDRNGIEVGDTLAFDL----
1140|hp|hwa        VSYNYTERHNITIGDEIQINRQ---
1832|hp|hut        VPFGWTNETGIETGDHVSIPESVRP
27220|hp|hbo       VPYGYTNETGVEVGDTVRIENY---
12315|hp|hma       VNRGWTNRTGVAVGDRVELPPEAT-
2771|hp|hhi        VNRGWANRTGVEVGDRVELPPEAM-
                       :    .   ** :