HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0719arCOG04738/2hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0719 nrc1 VNG1381 vng1381 no entry
tucHOG0719 hmu HMUK1071 Hmuk_1071 conserved hypothetical protein
tucHOG0719 hma RRNAC2893 hypothetical protein
tucHOG0719 hwa HQ3439A hypothetical protein
tucHOG0719 hla HLAC0011 Hlac_11 hypothetical protein
tucHOG0719 hbo HBOR01290 Hbor_01290 hypothetical protein
tucHOG0719 hut HUTA2973 Huta_2973 conserved hypothetical protein
tucHOG0719 hvo HVO_0093 HVO_0093 conserved hypothetical protein
tucHOG0719 nph NP0698A hypothetical protein
tucHOG0719 hhi 159 HAH_0159 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


698|hp|nph        MAGPLRFRRSNADWTRNRVREALLAPLEDRFGARLSEPWFAVGDDRYDAVRLEMDNGDIA
12893|hp|hma      ----------------------------------MNGPWFAPPEG-WAARRLEMDNGDLA
159|hp|hhi        MAGPLRLRRSNERWSEKRVRTDLLTPLQNTFGATMNGPWFAPPEG-WAARRLEMDNGDLA
2973|chp|hut      ----------------------------------MGRPWFRQPEG-YDARRFDMDNGDVA
11|hp|hla         MAQPIRFRRAPGGWSDDRVRAQLERPLDDNLGATASDPWFAPPPG-YEARRFDMADGSFA
1381|hp|nrc1      ------------------------------------------------------------
3439|hp|hwa       MARPLRFRHAPWKWNNSKVEEKLYRDLDQNLGATRRQPWFKSPPA-YTGDRFEMSNGDIA
1290|hp|hbo       MARPLRFRYAPGRWDEARVRRDIYDDLDSNLGATKETPWFKPPAD-FEAVRFEMNNGDIA
                                                                              

698|hp|nph        LFCFRPG------------RAYWLGNTETPEPLWRTNKETFSEAPDPVSRWAQRELTARI
12893|hp|hma      LFCWNGQ------------RAYWVGNTETPETLWRTEKYTFDEVPDEISEWVQRELFAQL
159|hp|hhi        LFCWNGQ------------RAYWVGNTETPETLWRTEKYTFDEVPDKISEWVQRELFAQL
2973|chp|hut      LFTWSDD------------VAYWMGNTETPKALWQTEKYTFDEVPDAVAEWAERELLATL
11|hp|hla         LFCWTDGDDNSPNGADGGPVGYWVGNTETPSELWRTDKYGFDEVPYPVSRWVQRELLAGL
1381|hp|nrc1      ------------------------------------------------------------
3439|hp|hwa       LFAWNDT------------EAYWLGNTETPKALWRTDKHGFGAVDNAISRWATRELTAQL
1290|hp|hbo       LFCWNDD------------TAYWMGNTETPEALWRTDKKGFSEVPHSVSRWVTRELTAQL
                                                                              

698|hp|nph        EVTDPWLADYEHLTWFFLPVFCSKDGRETTRRFFAEDAAGFPDADADAGLSFYESLLESG
12893|hp|hma      EVEDPWLTEYETLAHFFLPVFLSKDGRESTRTFFRDHAGGFPDADRADGLAFYDDFLATG
159|hp|hhi        EVEDPWLTEYETLAHFFLPVFLSKDGRESTRTFFRDHASGFPDADRADGLAFYDDFLATG
2973|chp|hut      HEEAPWLAEYPTISWFFLPVLLSKDGRHTSREFFRDHAAGFPECDRETALSYYEELLEGG
11|hp|hla         HDDEPWFAAYPHVSWFFLPVFCSKDGAETTRAFFRDHAAGFPDATREEGTGFVEETLRPG
1381|hp|nrc1      ------------------------------------------------------------
3439|hp|hwa       HVESPWLEPYPHLSWFFLPVFLSKDGRETTRTFFKKHAAGFPDAARENVLEFYEAVVRTR
1290|hp|hbo       HEESPWLEPYPHLSWFFLPVFLSKDGRETTREFFHDHAAGFPDATRDEALSFYEGFLATG
                                                                              

698|hp|nph        RLDDDRYTMAAKLGTSAGYDVTRMRATMSEFTVAKLFVDAGLDFDPEVEQESGHALDFAV
12893|hp|hma      ELDDYRYTMASKLGTSEGFDLSRMRATMGEFNVAKLLVDAGNDIRPEVELDSGHSVDFRV
159|hp|hhi        ELDDYRYTMASKLGTSEGFDLSRMRATMGEFNVAKLLVDAGNDIRPEVELNSGHSVDFRV
2973|chp|hut      VFPD-RYEMAAKLGTAERLNLTRMSATMSEFTVAKLLDDAGYDLAPENEVSSGHSIDFRV
11|hp|hla         TLDDYRETMAGKLGTSTSLDLVRMSAAIAEFTAARILTEAGYEVTPEIEVTTGHSLDFRA
1381|hp|nrc1      --------MAGKLGTSETLDVPRASAAMSEFHAAWLLGEAGYEVTPEIEVTTGHSLDFRA
3439|hp|hwa       VLDQWREVMAGKLGTSEYLDLTRMTAAMGEFNVAYLLDNAGYDIEPEITVSTGHAIDYRA
1290|hp|hbo       VLDDHREVMAGKLGTSEYLDLTRMTAAMGEFNAGKLLVDAGYDIVPEIDVTTGHAIDYRA
                          **.****:   :: *  *::.** .. :: :** :. **    :**::*: .

698|hp|nph        ------DGRLVEVTRPEPPARRTHADHPVAAVEETGRAKRSEQLAAH-PEAALFVDCTSF
12893|hp|hma      ------EDTLVEVTRPRPPSRRQ-VDTAVGAVKASGDAKTRDQLAAH-PGAVLVVDCSSF
159|hp|hhi        ------EDTLVEVTRPRPPSRRQ-VNTGIAAVKASGDAKTRDQLAAH-PGAVLVVDCSSF
2973|chp|hut      -DGDEQTGRLVEVTRPLPPSERS-AGSAVAAIKETVATKTGGQLADHGGGVTLLVDCSSF
11|hp|hla         TDPNTRTASLVEVTRPQPVSGRS-ASDPVAAVRDTAETKTSGQLEAHGGGVTLFVDCTSF
1381|hp|nrc1      -DREGEQGVLVEVTRPVPTSDRA-AGTPIAAVRETAATKTDGQLSEHGGGAVLVVDCSSF
3439|hp|hwa       --ETDEMATLVEVTRPTPTAKRT-AGTPIAAVRDTAQTKSRGQLKSHGGDVVLFVDCSSF
1290|hp|hbo       --SRNGDGTLVEVTRPLPTSKRS-AGTPVAAVRDTAETKSGGQLEEHGGGVVLFVDCSSF
                           ******* * : *  ..  :.*:  :  :*   **  *   ..*.***:**

698|hp|nph        TDAEWSAVAAERPTVGHEPTVVFRARPSGHIEGYRHGTLPFDLDGALSTA
12893|hp|hma      PDDDWHRVYGEQPDVGYSPTIVFRARPDGSMEGYAYGSVPFPLPF-----
159|hp|hhi        PDDDWRRVYGEQPDVGYSPTIVFRARPDGSMEGYAYGSVPFPLPL-----
2973|chp|hut      DDGEWSRILDAQPEIGHRPAVVFRVRPGGNTAAYTLGSVPIDLPAYVDVA
11|hp|hla         PADDWAAVREARPEVRHRPAVVLRARPDGHVEGYRKGSVPIDLSAAIDWV
1381|hp|nrc1      PDDEWRRIRGERPEVRHRPAVVFRLRPSGRVEGYTKGSVPLSLPQFD---
3439|hp|hwa       PDDEWQRIIAEKPSVHHQPAVVYRLRPSGHVSGYMKGDVPLILSDIG---
1290|hp|hbo       PDDDWFSVRDEKPEVHHRPAVVFRVRPSGRFEGYTKGRVPLDIPF-----
                     :*  :   .* : : *::* * **.*   .*  * :*: :