HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0718COG0144KOG2360 KOG1122 KOG2198arCOG00973tRNA and rRNA cytosine-C5-methylasesproliferating-cell nucleolar antigen

HOG Organism Gene ID Name Annotation
cHOG0718 nrc1 VNG0499 cna proliferating-cell nucleolar antigen
cHOG0718 hmu HMUK2830 Hmuk_2830 RNA methylase, NOL1/NOP2/sun family
cHOG0718 hma RRNAC0628 sun tRNA and rRNA cytosine-C5-methylase
cHOG0718 hwa HQ2637A sun tRNA and rRNA cytosine-C5-methylases
cHOG0718 hla HLAC1485 Hlac_1485 RNA methylase, NOL1/NOP2/sun family
cHOG0718 hbo HBOR16210 Hbor_16210 NOL1/NOP2/sun family putative RNA methylase
cHOG0718 hut HUTA0341 Huta_0341 RNA methylase, NOL1/NOP2/sun family
cHOG0718 hvo HVO_1594 HVO_1594 cna tRNA and rRNA cytosine-C5-methylases
cHOG0718 nph NP4072A cna rRNA methylase
cHOG0718 hhi 1286 sun tRNA and rRNA cytosine-C5-methylase
MUSCLE (3.6) multiple sequence alignment


499|gene|nrc1       ---------------MDALSRYEPIIDDFEGFLAACERPLPTTVRVNPLAVTPDRAVEAL
4072|gene|nph       ---------------MEPLSRYDPLVDDPAAFHEACERPLPSVVRVNRIKATAESVRQAF
2637|gene|hwa       ---------------MDPIERYATLIDDVTAFRDACARPLPSVVRVNTIKSSVGRTQEAL
1485|gene|hla       ---------------MNPLERYEPLVDDAAAFRAACDRPLPSVVRVNEMAASPARVREAF
16210|gene|hbo      ---------------MNPLERYAPLVDDEDAFFAACDRPLPSVVRVNTIKTTVDRARSAL
341|gene|hut        ---------------MDVLQRYESLFEDWSGFRAACRRPLPSVVRVNTLKTTVERAKTAL
10628|gene|hma      MPFETHKPTASERRTMEPLDRYRPIIDDFEAFIDACERPLPSAIRVNTIKATVERVRTAL
1286|gene|hhi       ---------------MEPLDRYRPIIDDFEAFIDACERPLPSAVRVNTIKASVERVRTAL
                                   *: :.** .:.:*  .*  ** ****:.:*** :  :   .  *:

499|gene|nrc1       AAEGVAVDRREWHPGVLEVDT-NKPGNTWPYVHGWVHGQEEVSCVPPRVLDPEPGDVVWD
4072|gene|nph       DEAGVDYEPVDWHDGLFRLGEGESPGNSWPFVHGWVYGQEEVSAVPALALAPQPGERVLD
2637|gene|hwa       NEANINYEPIGWHSGLFKLET-NRPGISWPYFHGWLHGQEEVSVLPALAVDPDPGEIVWD
1485|gene|hla       DEEGVAYEPVDWHDGLFRLPD-GNPGGNWPYVHGWTHGQEEVSVLPGLALDPQPGEHVWD
16210|gene|hbo      DAENVGYEPTDWHPGILKLDE-RGPGTTWPYFHGWLHGQEEVSALPALALDPEPGEIVWD
341|gene|hut        ETEGITYETVDWHDGLLRLPD-DNPGSNWPYVQGWLHGQEEVSALPPVVLDPDPGDRVWD
10628|gene|hma      ADADIAYDPVDWHDGLFVLPE-DSPGANWPYFHGWIHGQEEVSVIPATVLDPQPGERVWD
1286|gene|hhi       ADADIAYEPVDWHDGLFVLPE-DSPGANWPYFHGWIHGQEEVSVIPATVLDPQPGERVWD
                       .:  :   ** *:: :     ** .**:.:** :****** :*  .: *:**: * *

499|gene|nrc1       ACAAPGGKTAQIAAEIDDDGLVVANDDNLGRLSALRGNCDRLGVTSAAVTNTDARRATLD
4072|gene|nph       CCAAPGSKTTQLAALMDDRGLLVGNDNNLGRLSALRSNAERCGVTNIAVTRQDARNLSLK
2637|gene|hwa       ACAAPGSKTTQLAALMDDTGVVIGNDNNLGRLSALRHNAERLGVTNLVVTNQDARNFSFN
1485|gene|hla       ACAAPGSKTTQIADAMNDEGTVVANDNNLGRLSALRHNAERLGITNAIVTNQDARNFSTK
16210|gene|hbo      ACAAPGSKTTQLADLMDDTGVLIGNDNNLGRLSALRHNAERLGVSNLVVTNQDARNYSLK
341|gene|hut        ATAAPGSKTTQLAALMDDEGAIVATDNNLGRLSALRSNAERLGVTNLAVTNEDARNHSLK
10628|gene|hma      ACAAPGSKTTQLAALMEDTGEVVATDNNLGRISALRTNTERLGATTVAVTHEDGRNHSLK
1286|gene|hhi       ACAAPGSKTTQLAALIEDTGEVVATDNNLGRISALRTNTERLGATTVAVTHEDGRNHSLK
                    . ****.**:*:*  ::* * ::..*:****:**** * :* * :.  **. *.*. : .

499|gene|nrc1       AFPD-------VAAVDAALVDAPCSCEGTIRKNADALDGAGASASRSLGRLQADILARAV
4072|gene|nph       PFGG--------ERFDRTLVDVPCSCEGTVRKNPDAVDGWSLDHIEGIAGVQKAILERAI
2637|gene|hwa       PFGGRTERANRIEAFDHALVDAPCSCEGTIRKNPDAFEQWSREHVMSVVAIQKDILRRAV
1485|gene|hla       PLAF--------DEFDRALVDAPCSCEGTCRKNLDVVDQWTLDHVHAVAGIQKGILARAV
16210|gene|hbo      PFGEDTDDSAAIDAFDKALVDAPCSCEGTIRKNPDALDRWTMNHVHSVAGIQKGILRRAV
341|gene|hut        PFDG--------RQYDHALVDAPCSCEGTIRKNPDALAQWSLDHVSGIAGAQKGILRRAV
10628|gene|hma      PFDG--------EGYDRALVDVPCSCEGTIRKNPDTLEDWSLSHVEGISGVQKGILKRAV
1286|gene|hhi       PFGG--------EGYDRALVDVPCSCEGTIRKNPDTLEDWTLSHVEGISGVQKGILKRAV
                    .:             * :***.******* *** *..     .   .:   *  ** **:

499|gene|nrc1       ALTRPGGTVVYSTCTFAPEENEAVVDEVLGRTDSRLVEFDVG--LASAPGLTEWGDASYD
4072|gene|nph       EVTRDGGTVVYSTCTFAPEENEAVLQHALDGGDCRLVDFDLP--LESVPGVTDWEDERFD
2637|gene|hwa       QATRPGGTVVYSTCTFAPEENEGVVNHVLESESCRVVQWNPPAGFKTISGITHWDNESYD
1485|gene|hla       QATRSGGTVVYSTCTFAPEENEAVLDHVLGEEDCEIVAFDLP--LDTVPGVTEWDGETYD
16210|gene|hbo      QATRPGGTVVYSTCTFAPEENEAVLDHVLGEEDCKLVPWDAPDNFETAPGVTEWEDEEYD
341|gene|hut        EVTKPGGTVVYSTCTFAPEENEAVLDHALEETDARLVSSDLP--LDSRPGVTEWDGETFD
10628|gene|hma      EVTEPGGTVVYSTCTFAPEENEAVLDYVLDEVACEIVDYDLP--LNHAPGITDWEDESFD
1286|gene|hhi       EVTEPGGTVVYSTCTFAPEENEAVLDYVLGETACEIVDYDLP--LDHAPGITEWQDETFD
                      *  *****************.*:: .*    . :*  :    :   .*:* * .  :*

499|gene|nrc1       DSLARAQRYYPHHNDTGGFFAAKL------------EVTA-
4072|gene|nph       DAVRKAQRIYPHHNDTGGFFCAKL------------EVAR-
2637|gene|hwa       PSMELTHRVYPHHNDTGGFFCAKL------------EVTS-
1485|gene|hla       ESVTRAHRVYPHHNDTGGFFCAKLRVGGEDDETGDEEVAA-
16210|gene|hbo      PSVELAHRVYPHHNDTGGFFCAKL------------EVTA-
341|gene|hut        PSVRKAHRVYPHLNDTGGFFVAKL------------EVPA-
10628|gene|hma      PSVADAKRIYPHHNDTGGFFCAKL------------EVPAE
1286|gene|hhi       PSVADAKRIYPHHNDTGGFFCAKL------------EVPAE
                     ::  ::* *** ******* ***            **.