HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0717COG2047arCOG00348Uncharacterized protein (ATP-grasp superfamily)hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0717 nrc1 VNG0546 vng546 no entry
cHOG0717 hmu HMUK2882 Hmuk_2882 protein of unknown function DUF75
cHOG0717 hma RRNAC3510 hypothetical protein
cHOG0717 hwa HQ1257A hypothetical protein
cHOG0717 hla HLAC1007 Hlac_1007 protein of unknown function DUF75
cHOG0717 hbo HBOR25200 Hbor_25200 conserved hypothetical protein TIGR00162
cHOG0717 hut HUTA2792 Huta_2792 protein of unknown function DUF75
cHOG0717 hvo HVO_0697 HVO_0697 conserved hypothetical protein TIGR00162
cHOG0717 nph NP1624A hypothetical protein
cHOG0717 hhi 728 HAH_0728 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


546|chp|nrc1       MDELSIEWVAEPSLDDPALVEGLPGVGHVGKLVAEHVIAEADSELVCRVHSEYFPPQVTV
1624|hp|nph        MDEFDIERPADPELDNPVLIEGLPGVGHVGKLAAEHLLEEFDAELVRRIYSEHFPPQVTV
1257|hp|hwa        MEDIEIETVGEATLRDPVLVEGLPGVGHVGKLAVEHLVEEFDSEELTRVYADEFPPQVTV
25200|chp|hbo      MEDIEVETLADPDLRDPVLVEGLPGVGHVGKLAVEHLLEELDSEPVRYIYADEFPPQVTL
1007|gene|hla      MDDIEIDEVATPELDDPVLIEGLPGVGHVGKLAAEHLLEEFDGELVRRVYSTEFPPQVSI
2792|hp|hut        MDEYETEVLADVDLEEPVLVEGLPGVGHVGKLAAEHLLEELDSTPVRRVYSQHFPPQVSV
13510|hp|hma       MDEFDIERVADPDLDEPVLVEGLPGVGHVGKLAAEHLLEELESELVRRVYSTHFPPQVSI
728|hp|hhi         MDEFDIERVADPDLDEPVLVEGLPGVGHVGKLAAEHLLEELESELVRRVYSTHFPPQVSI
                   *:: . :  .   * :*.*:************..**:: * :.  :  :::  *****::

546|chp|nrc1       GDDSVAELAAAEIHAVET-GGRDLLVVTGDHQAQDTVGQYRVTEAFLDAAAEFDATDVFS
1624|hp|nph        E-DGRTQLACAEVYAISA-AERDCLVLTGDHQAADGPGHYRLTEAFLDVAAAFDVSRIFA
1257|hp|hwa        DDDGVTELAHASFHAVST-DGPDLLILTGDHQAQSHAGHYHLTDTFLDIAEDMGAESVYA
25200|chp|hbo      NDDSVAQLARAEFHAVDA-GDRDLLVLTGDHQAQTNSGHYHLTDAFLDIAEEFGVEEGYA
1007|gene|hla      DGDGVAELTCAEFHAVET-DGADLLVLTGDHQAGSNAGHYKLTTTFLDIAEEFGATRAFA
2792|hp|hut        E-DGI-ELASATFHAVTPEDGQDMLVLSGDHQAQDNVGHYGLVETFLDVAADFDVERIVA
13510|hp|hma       D-EGQAQLACAEFHAVTPEEGQDLLVLSGDHQAQNNQGHYGLTDTFLDIADEFGIQRVFA
728|hp|hhi         D-DGQAQLACAEFHAVTPEEGQDLLVLSGDHQAQDNQGHYGLTDTFLDIADEFGVQRVFA
                     :.  :*: * .:*: .    * *:::*****    *:* :. :*** *  :.     :

546|chp|nrc1       LGGVPTGELVEDHDVIGAVSSAALKDGLADAGVEFRSEEPAGGIVGSSGLLVGLGGKRGF
1624|hp|nph        LGGVPTGELVETPDVIGAATTDDLIEELEAVDVEFRENEPAGGIVGVSGLLLGLGERRGY
1257|hp|hwa        LGGVPTGELVEEPDVLGAVATNGGIDPLSDAGVEFREGEPAGGIVGVSGLLLGLGGRRGL
25200|chp|hbo      LGGVPTGELVDEPSVLGAVTDEDDVERLEAVDVEFREDEPAGGIVGVSGLLLGLGERRGL
1007|gene|hla      LGGVPTGELVEEYTVLGAVSDGDLIEGLEDVGVEFRPDEPAGGIVGVSGLVLGLGGRRGF
2792|hp|hut        LGGVPTGELIEEYDVIGAVTTEDLETELEDAGVDFRENEPAGGIVGVSGLLLGMGQRREW
13510|hp|hma       LGGVPTGELIEEYDVLGATTTEDFKETLEESGVAFREDEPAGGIVGVSGLLLGLSKRRDV
728|hp|hhi         LGGVPTGELIEEYDVLGATTTEDFKETLEDAGVAFREDEPAGGIVGVSGLLLGLSKRRDV
                   *********::   *:**.:       *   .* **  ******** ***::*:. .*  

546|chp|nrc1       DAACLMGETSGYLVDPKAAKAVLAVLGARLDFEMDEEALDDRAEEMEEVVSRLQDM--EE
1624|hp|nph        EAACLMGETSGYLVDPKSARVVLEALEETVPLDIGYDSLEERADEMEEVVKQIQQMEQNA
1257|hp|hwa        SAACLMGETSGYLVDPTSAQAVLEVLETVVGFEVGYESLEERAEEMKEVVEKIQQMQGQQ
25200|chp|hbo      SVACLMGETSGYLVDPQSAQVVLEVLQDVIDFEVGFESLEERAEEMKEVVGKIQEMQSQQ
1007|gene|hla      DAACLMGETSGYLVDPKSARAVLEVLADHLDFSIDYESLEDRAEEMEEVVGKIQEM--QD
2792|hp|hut        PAACLMGETSGYLVDPKSAQAVLEILQDLLGFEVDYASLEERADDMEEVVRKIQEME-QG
13510|hp|hma       PASCLMGETSGYLVDPKSAQAVLEILQDVIGFEVDYSSLEDRADEMEEVVRKIQEMEQQN
728|hp|hhi         PASCLMGETSGYLVDPKSAQAVLEILQDVIGFEVDYSSLEDRADEMEEVVRKIQEMEQQN
                    .:************* :*..**  *   : :.:.  :*::**::*:*** .:*:*  : 

546|chp|nrc1       TPSPGDEDLRYIG
1624|hp|nph        TAAPSEEDLRYIG
1257|hp|hwa        QGMPTDDDLRYIG
25200|chp|hbo      QGM-NDDDLRYIG
1007|gene|hla      GPAVPDDDLRYIG
2792|hp|hut        APSSPDEDLRYIG
13510|hp|hma       SPSPADEDLRYIG
728|hp|hhi         SPSPADEDLRYIG
                        ::******