HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0716COG1812arCOG01678Archaeal S-adenosylmethionine synthetaseS-adenosylmethionine synthetase

HOG Organism Gene ID Name Annotation
cHOG0716 nrc1 VNG1297 metK S-adenosylmethionine synthetase
cHOG0716 hmu HMUK2306 Hmuk_2306 Methionine adenosyltransferase( EC:2.5.1.6 )
cHOG0716 hma RRNAC1233 metK S-adenosylmethionine synthetase
cHOG0716 hwa HQ2584A metK S-adenosylmethionine synthetase
cHOG0716 hla HLAC1394 Hlac_1394 S-adenosylmethionine synthetase (MAT)
cHOG0716 hbo HBOR15700 Hbor_15700 methionine adenosyltransferase( EC:2.5.1.6 )
cHOG0716 hut HUTA0513 Huta_0513 Methionine adenosyltransferase
cHOG0716 hvo HVO_1649 HVO_1649 S-adenosylmethionine synthetase
cHOG0716 nph NP3100A mat S-adenosylmethionine synthetase
cHOG0716 hhi 1827 metK S-adenosylmethionine synthetase
MUSCLE (3.6) multiple sequence alignment


1297|chp|nrc1       MTDRNIQVQSLDRSAVEDDAVEIVERKGLGHPDSICDGIAEHVCETLAREYRDRVGHVLH
1394|gene|hla       -MDRNIQVSRLDRRAVEDQEVEIVERKGIGHPDSICDGIAESVSRALSQLYLDRVGKVLH
2584|gene|hwa       MTERNIAIEAANRDAVEDQRVEIVERKGIGHPDSICDGIAETVSRALSQLYLDRVGHVLH
15700|gene|hbo      MTERNIKIEAVERLAVEDQSVEIVERKGIGHPDSIADGIAESVSRALSNLYLDRVGKVLH
11233|gene|hma      MTERNIHVQPASGLAVEDQDIEVVERKGIGHPDTICDGIAETVSRALAQTYIDRFGTVLH
1827|gene|hhi       MTERNIHVQPASGLAVEDQDIEVVERKGIGHPDSICDGIAETVSRALAQTYIDRFGTVLH
513|gene|hut        MSERNIRITQASGQAVEDERVEVVERKGIGHPDSICDGLAEAVSQALAGAYLDRVGKVLH
3100|gene|nph       MSDRNIRVEPVVGRAVEEQDVEIVERKGLGHPDSLCDGIAEHVSQALARAYIDRVGKVLH
                      :*** :      ***:: :*:*****:****::.**:** *. :*:  * **.* ***

1297|chp|nrc1       FNTDETQLVAGDAAPAFGGGNVIDPIYILVVGRATSHYVEADGTEHHIPVESIALEAARE
1394|gene|hla       YNTDETQLVAGRAAPAYGGGEVVEPLYVLIVGRATKEY---EGE--QLPVDSTALAAARD
2584|gene|hwa       YNTDETQLVAGESIPDFDGGEVVEPIYILIVGRATKKY---NGQ--RLPVDSTAVSAART
15700|gene|hbo      YNTDETQLVAGESAPAFGGGEVIEPMYILLVGRATKKY---DGE--KLPVDSVALEAARD
11233|gene|hma      YNTDETQLVAGTAAPAYGGGEVLEPIYILVVGRATKKF---DGE--RIPAESIALRAARD
1827|gene|hhi       YNTDETQLVAGTAAPAYGGGEVLEPIYILVVGRATKKF---DGE--RIPAESIALQAARD
513|gene|hut        YNTDETQLVAGTSAPAFGGGEVIEPIYLLLVGRATKEY---QGT--RIPTDTIALEAARE
3100|gene|nph       YNTDETQLVAGTAAPAFGGGEVVDPIYLLITGRATKEY---EGT--KIPAETIALRAARE
                    :********** : * :.**:*::*:*:*:.****. :   :*   .:*.:: *: *** 

1297|chp|nrc1       YLRETLPHLDLETDVIVDVKLGEGSGDLQDVFTDDDDGPAVPMANDTSFGVGHAPLTETE
1394|gene|hla       YLSEAIPELEYGTDVIIDVKLGEGSGDLQDVF--GEETQQVPMANDTSFGVGHAPLTETE
2584|gene|hwa       YLRENIPALTLGTDVIVDVRLGQGSGDLKDVF--GENNVEIPMANDTSFGVGHAPLTETE
15700|gene|hbo      YLRENIPELEFGTDVIVDVKLGEGSGDLQDVF--GEDNVEVPMSNDTSFGVGHAPLTETE
11233|gene|hma      YLDEQFPHLDLGSDVIVDVQFGEGSGDLQTVF--GEEA-AIPMANDTSYGVGHAPLTETE
1827|gene|hhi       YLDEQFPHLDLGSDVIVDVQFGEGSGDLQTVF--GEEA-AIPMANDTSYGVGHAPLTETE
513|gene|hut        YLDETFPHLDVGSDVIVDVRLGEGSGDLQEVF--GEDG-AVPMANDTSYGVGHAPLTETE
3100|gene|nph       YINETLPFLEFGTDVVVDVKLGEGSGDLQEVF--GEDGKQVPMSNDTSFGVGHAPLTETE
                    *: * :* *   :**::**.:*:*****: **  .::   :**:****:***********

1297|chp|nrc1       RIVLEAERSLNGPYAEHTPAVGEDVKVMGKREDDHIDLTIAAALVDAHVPDMDAYIAQVE
1394|gene|hla       TIVYEAEHELNTTYHADHPELGPDVKIMGKREGDRIDITVAAAMVDRYVDGLDEYDDAVE
2584|gene|hwa       KIVQAVEMQLNGPYADNHPVIGPDIKVMGKRENNSIDITVAAAMIDRYVADLEDYADAIE
15700|gene|hbo      NIVLNVERQLNGPYAERHPYLGPDVKVMGKREGDYIDITVAAAMVDAHIDDMADYKDAVE
11233|gene|hma      QIVRNTEQKLTGEYAESNPVVGQDVKVMGKREGDHIDVTVAVAMVDEHVPDLDAYKTAVS
1827|gene|hhi       KIVLNTEETLTGEYAESNPVVGQDVKVMGKREGDHIDVTVAVAMVDEHVPDLDAYKAAVS
513|gene|hut        QIVLNTERRLNGEYTDENPEIGQDIKVMGKREGDEIDVTVAAATVDAHVNDIHEYRDAVE
3100|gene|nph       RIVLEAERALNGDYSDDNPAVGQDIKVMGKREGDDIDVTVAVAMVDRYVDDLDGYEAAVA
                     **  .*  *.  *    * :* *:*:*****.: **:*:*.* :* :: .:  *   : 

1297|chp|nrc1       AIREHVFDLATEHTDREVTVHVNTADDYESGSIYLTTTGTSAEQGDDGSVGRGNRANGLI
1394|gene|hla       NVREFVTELAESRTDREVHVDVNTADDYDEGSVYLTVTGTSAEQGDDGSVGRGNRANGLI
2584|gene|hwa       NIRAFVTDVAHRHTNREVTVAVNTADDYDTGSIYLTVTGTSAEMGDDGSVGRGNRANGLI
15700|gene|hbo      HVREYVSDVATDYTDREVNVDVNTADNYDEGSIYLTVTGTSAEMGDDGSVGRGNRANGLI
11233|gene|hma      DVRAFVTDLAEEYTDRDVTVHVNTADDYDAESIYLTTTGTSAEQGDDGSVGRGNRANGLI
1827|gene|hhi       DVQAFVTDLAEEYTDRDVTVHVNTADDYDAESIYLTTTGTSAEQGDDGSVGRGNRANGLI
513|gene|hut        GVREFVADLATEYTDRDVRVQVNTADDYEEGAIYLTTTGTSAEQGDDGSVGRGNRANGLI
3100|gene|nph       GVREFVADLATDYTDRNVSVHVNTADDYDEGAIYLTTTGTSAEQGDDGSVGRGNRSNGLI
                     :. .* ::*   *:*:* * *****:*:  ::***.****** ***********:****

1297|chp|nrc1       TPNRAMSMEATSGKNPVNHIGKIYNLLSTQIAEAVVAEVDGIRDLRVRLLSQIGRPIDEP
1394|gene|hla       TPNRPMSMEATSGKNPVNHIGKIYNLLSTRIAESVTEEVDGIRDLQVRLLSQIGRPIDEP
2584|gene|hwa       TPNRPMSMEATSGKNPVNHIGKIYNLLSTDIAESVVADVDGIRDLQIRLLSQIGRPIDEP
15700|gene|hbo      TPNRPMSMEATSGKNPVNHIGKIYNLLSTDIAEAVVADVDGIRDLQVRLLSQIGRPIDEP
11233|gene|hma      TPNRPMSMEATSGKNPVNHIGKIYNLLSTEIAQSVANEVDGIRQVQMRLLSQIGSPIDEP
1827|gene|hhi       TPNRPMSMEATSGKNPVNHIGKIYNLLSTEIAQSVASEVDGIRQVQMRLLSQIGSPIDEP
513|gene|hut        TPNRPMSMEATSGKNPVNHIGKIYNLLSTEIAESVVAEVDGIRQLQVRLLSQIGSPIDDP
3100|gene|nph       TPNRSMSMEATSGKNPVNHIGKIYNLLSTEIARTVVDEVDGIREIRIRLLSQIGQPIDKP
                    ****.************************ ** :*. :*****::.:******* ***.*

1297|chp|nrc1       HVADVEVVTEDGTAVADVDAEIERIVDAQLASVTDLTRRVIDGERTTF
1394|gene|hla       HVADAQLVTEDGVALGDIEPKVLEIVDRELANVTDVTRSVIDGDVSTF
2584|gene|hwa       HIADAKIVTESNVNLQAIEPEIRAIIDNRLADVTSITERVINDELTTF
15700|gene|hbo      HVADAKVITEDGVELSDIEADVQAIIDERLADVTNVTRRVIDGEMTTF
11233|gene|hma      HVADATVVTEDGVAVGDVEADIQATIDDELADVTDITRQVIEGDLSTF
1827|gene|hhi       HVADATVITEDGVAVGDVEADIQATIDDELADVTDITRQVIDGNLSTF
513|gene|hut        HVADATIITADGVAISDVEDEVEAIIDEELADITGVTERVIDGDLSTF
3100|gene|nph       HVADANLVTEDGIEIADIEDEVEAIIDAELENVTSITERVIDGELTTF
                    *:**. ::* ..  :  :: .:   :*  * .:*.:*  **:.: :**