HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0713COG1407arCOG01150Predicted ICC-like phosphoesterasesphosphoesterase

HOG Organism Gene ID Name Annotation
cHOG0713 nrc1 VNG1252 yhcR phosphoesterase
cHOG0713 hmu HMUK2420 Hmuk_2420 metallophosphoesterase
cHOG0713 hma RRNAC1137 yhcR1 phosphoesterase
cHOG0713 hwa HQ2403A phosphoesterase
cHOG0713 hla HLAC0625 Hlac_625 metallophosphoesterase
cHOG0713 hbo HBOR18990 Hbor_18990 putative phosphoesterase
cHOG0713 hut HUTA0546 Huta_0546 metallophosphoesterase
cHOG0713 hvo HVO_1336 HVO_1336 phosphoesterase
cHOG0713 nph NP3964A hypothetical protein
cHOG0713 hhi 1742 yhcR2 phosphoesterase
MUSCLE (3.6) multiple sequence alignment


2403|gene|hwa       MPTDTDTDTDAATGPLVEPLPSVPAAIA----RIETETALVIADYHAGIEIGLRYERGVE
3964|hp|nph         ---------------MLEPVFGEPLAVA----DCGPERVLVVADYHAGIEVGLRAD-GVE
1252|gene|nrc1      -------------MALVEPVLGEPAAVA----ETGGGRALVVADYHAGIEVSLRRK-GLE
625|gene|hla        --------MAPGASPAVEPVVGEPAAVA----DLGDRRLLLVADVHAGIEVGLRYERGVE
18990|hp|hbo        -------MARRGDGPIVEPVPGDPAAVAHLGPNAGDETALVVADYHAGIEAGLRYERGVE
546|gene|hut        --------------MAVEPVPGAPAATV----EVPDGRALVVADVHAGIEAGLRKE-GVE
11137|gene|hma      --------------MRVEPLPGVPAATV----DTDGERLLAVADYHAGIEAGLRYE-GVE
1742|gene|hhi       --------------MRVEPLPDVPAATV----DTDGERLLAVADYHAGIEAGLRYE-GVE
                                    :**: . * * .           * :** ***** .** . *:*

2403|gene|hwa       LDSNAEDRRRRLLELLTQHPVDRLIILGDAGHRIGNPADEETQELMSLFTSVLNRVPITV
3964|hp|nph         LRSAAEKRRKRLLSAIESELVDRCLFLGDLGDSIGSPSRTERAELRELLSAVTDHVPVTV
1252|gene|nrc1      VEGRGPQRRRRLRRLVREEGADRLVVLGDVGHAIGAPEEAEREELAALFDAVD--VPATV
625|gene|hla        LDSRADERRERLCGLIAETDADRLVILGDLAHRIAAPEGDEREELVELIRAVTDRVPMTL
18990|hp|hbo        LDSDADVRLARLLRLLDETNPDRLVVLGDLGHRIGAPKGDEADELETFVERTVARVPITL
546|gene|hut        LASGADQRRENVLSLVAETDPDRLIVLGDLGHAIGTPQRDEREEIDRLVSEITERVPLTL
11137|gene|hma      LQSAAEARRERLLTCLRRARADRLVVIGDLGHAIGDPFADERAELETLFDALD--VPVTL
1742|gene|hhi       LQSAAEARRERLLTCLRRARADRLVVIGDLGHAIGDPFADERAELETLFDALD--VPVTL
                    : . .  *  .:   :     ** :.:** .  *. *   *  *:  :.      ** *:

2403|gene|hwa       VRGNHDAGIESVATTVETDSTQIEHTINVTDASGIKCG--------------HVGFVHGH
3964|hp|nph         TKGNHDGGIESITEAFDA--------VNVVDGRGTTIG--------------SVGFCHGH
1252|gene|nrc1      VVGNHDSGIEDVVPAD----------VTVTPSDGAVLG--------------DVGFAHGH
625|gene|hla        VEGNHDAGVAEAFADD----------LDVIGAGGGVLGGDGGERDDDTTTGTGVGVLHGH
18990|hp|hbo        VRGNHDGGIAEAFGDR----------IDVTDGSGIRLG--------------RVGFVHGH
546|gene|hut        VKGNHDGEIESLLADREG--------VAITDGSGVRLG--------------SVGFAHGH
11137|gene|hma      VKGNHDGGLEPVLSDLDAD-------VEVTPGHGTRLG--------------SVGFAHGH
1742|gene|hhi       VKGNHDGGLEPVLSDLDAD-------VEVTPGHGTRIG--------------AVGFAHGH
                    . ****. :                 : :  . *   *               **. ***

2403|gene|hwa       SWPDETVLDCDVLCVGHEHPQLRVADHVGGSQQTRAWLRGPLDWTPFKNKLGIERSFDSP
3964|hp|nph         TWPSASVIGADVVVVGHEHPLVRLEDEVGGGRTERVWLRGRIDPAGFPDNDTVG------
1252|gene|nrc1      TWPSRAVLEAETVCIGHEHPAVRLTDDVGGTRVQRAWLRGPLDPAPFTDHYGEA------
625|gene|hla        TWPNPELLDADVVCMGHEHPQVRLEDAVGGSRVERAWLRGELDPTAFVKDGEVD------
18990|hp|hbo        TWPSCEVVESEVVCAAHEHPAVRLADSVGGSRKERAWLRGPMNPDPFAEALGLD------
546|gene|hut        TWPAPDVLAAETVCIGHEHPVVRLEDEVGGRRKERVWLRGAIDPVPFREHDDDT------
11137|gene|hma      TWPAPDVLEADVVCVGHEHPVVRLEDSVGGAQKERAWLRGSLVTEPFAEQFDQP------
1742|gene|hhi       TWPAPDVLEADVVCVGHEHPVVRLEDSVGGAQKERAWLRGSLVSEPFAEQFDQP------
                    :**   :: .:.:  .**** :*: * *** .  *.**** :    * .           

2403|gene|hwa       DNTQNVNRDPPDVILFPAFNERSGGTQVNTD-EGFLSPFLPAAFEKNHTDAYLLDGTRLG
3964|hp|nph         ----------DRLVVCPAFNERSGGTRIN-ERDEFLSPFLPDGLAD--GDAYLLDGTRLG
1252|gene|nrc1      ---VDAH---GDLAVFPAFNDLSGGTWVNVDGQGFLAPFLPAGCPD--AELYLQDGTRLG
625|gene|hla        ---PAAATDPPELVVFPAFNERSGGTWVNVDGQSFLAPFLPDALPA--GDAYLLDGTRLG
18990|hp|hbo        --VVELAWQSPELVVFPAFNDRSGGTWVNVEGQEFLSPFLPDGVFD--ADAYLLDGTRLG
546|gene|hut        --RLQVD---GELVVFPAFNDLSGGTWINVAGQSFLSPFLPEGLAD--GTAYLLDGTRLG
11137|gene|hma      ---VENA---PDIVVFPAFNDRSGGTWVNVDGQEFLAPFLPEGMAD--TEAFLLDGTRLG
1742|gene|hhi       ---VENA---PDIVVFPAFNDHSGGTWVNVDGQEFLAPFLPEGMAD--TEAFLLDGTRLG
                                : : ****: ****.:*   : **:**** .        :* ******

2403|gene|hwa       PYQSV
3964|hp|nph         PYRDV
1252|gene|nrc1      RFDRV
625|gene|hla        DFRRI
18990|hp|hbo        PYRSV
546|gene|hut        PYDQI
11137|gene|hma      AYRQV
1742|gene|hhi       AYRQV
                     :  :