HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0710COG0640arCOG02943transcriptional regulator

HOG Organism Gene ID Name Annotation
cHOG0710 nrc1 VNG0293 arlR3 transcriptional regulator
cHOG0710 hmu HMUK3207 Hmuk_3207 conserved hypothetical protein
cHOG0710 hma RRNAC1811 hypothetical protein
cHOG0710 hwa HQ1169A transcription regulator, ArsR like
cHOG0710 hla HLAC0549 Hlac_549 hypothetical protein
cHOG0710 hbo HBOR24410 Hbor_24410 transcriptional regulator, ArsR family
cHOG0710 hut HUTA2906 Huta_2906 transcription regulator, ArsR like
cHOG0710 hvo HVO_0772 HVO_0772 predicted sugar kinase
cHOG0710 nph NP1176A transcription regulator
cHOG0710 hhi 2337 HAH_2337 transcription regulator
MUSCLE (3.6) multiple sequence alignment


293|hp|nrc1         MSASATEDKP---APVDDEEFRSRLQELPPSAKLVAKVLEIDSPLSQGELADESLLPDRT
11811|hp|hma        MSALTENAAP---APFTDEEFRDTLRELPPSAKLVAKVLEDDAPLSQGDLAESSLLPDRT
2337|gene|hhi       MSALTENAAP---APFTDEEFRDTLRELPPSAKLVAKVLEDDAPLSQGELAENSLLPDRT
1176|gene|nph       MSTTTEERSRQSESPMSDPEFRETLRELPPSAKLVAKVLEGASPMSQGQLAEKSLLPDRT
2906|gene|hut       MSTTIEDGSR-TEIILTKGEFRERLRELPPSAKLIAKVLETDQPLSQGQLATESLLPDRT
1169|gene|hwa       MSTSVVDPEN--AVQLSKSEFRSRLRELPPSAKLVVKVLETDSPLSQGQLAEESLLPDRT
549|hp|hla          MSTSHAETAD--QDRLSESEYRDRLRELPPSAKLVAKVLEGDAPLSQGGLADESLLPDRT
24410|gene|hbo      -----MNRED----SLSEGEFRERLRELPPSAKLVAKVLEGDAPLSQGELAEESLLPDRT
                          :        . . *:*. *.********:.****   *:*** ** .*******

293|hp|nrc1         VRYALNRLDEQHLVDSRYSFEDARKQVYYLAG--
11811|hp|hma        VRYALNRLEESGLVDSRYSFTDARKQVYFLTV--
2337|gene|hhi       VRYALNRLEESGLVDSRYSFTDARKQVYFLTV--
1176|gene|nph       VRYALNRLEEEDLVDSRYSFNDARKQVYFLIN--
2906|gene|hut       VRYALNRLEDADLVSSRYSYRDARKQVYYLTTE-
1169|gene|hwa       VRYALSRLEENELIGSRYSFKDARKQVYFLNDHV
549|hp|hla          VRYALNRLEEEGLVDSRYSFKDARKQVYYLTV--
24410|gene|hbo      VRYALNRLEETELVSSRYSFKDARKQVYFLNT--
                    *****.**::  *:.****: *******:*