HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0708COG0526KOG3414 KOG0190 KOG0191 KOG0907 KOG0910 KOG1672arCOG01972Thiol-disulfide isomerase and thioredoxinsthioredoxin

HOG Organism Gene ID Name Annotation
cHOG0708 nrc1 VNG2600 trxA2 thioredoxin
cHOG0708 hmu HMUK0312 Hmuk_0312 Thioredoxin domain
cHOG0708 hma RRNAC2110 trxA3 thioredoxin
cHOG0708 hwa HQ1323A trxA thioredoxin
cHOG0708 hla HLAC0372 Hlac_372 Thioredoxin domain protein
cHOG0708 hbo HBOR27560 Hbor_27560 thioredoxin domain-containing protein
cHOG0708 hut HUTA0326 Huta_0326 Thioredoxin domain
cHOG0708 hvo HVO_0438 HVO_0438 trxA thioredoxin
cHOG0708 nph NP1310A trxA_1 thioredoxin
cHOG0708 hhi 2600 trxA2 thioredoxin
MUSCLE (3.6) multiple sequence alignment


1323|gene|hwa       MTVKLLDFYADWCGPCKTQDPILDELESDY-NEVAFEKIDVDSKQDIANQYEVRSLPTVV
326|gene|hut        MTVTLMDFHADWCGPCKTQEPILEDLEDDW-PEVDFERIDVEEKQDIANEYQVRSLPTLI
372|gene|hla        MTVRLLDFHADWCGPCKTQDPILEEIQEDLGDAFELQKVNVDEEQDVANQYQVRSLPTLI
2600|gene|nrc1      MTVTLKDFYADWCGPCKTQDPILEELEADYDEDVSFEKIDVDEAEDVANEYQVRSIPTIV
1310|gene|nph       MSVTLKDFYADWCGPCKTQDPILEDLEADY-PDVDFEKVDVDAAQDVANEYQVRSLPTLI
438|gene|hvo        MTVRLLDFYADWCGPCKTQDPILDELEGDY-ETVEFVKVDVDEEQDVANQYQVRSLPTLI
27560|gene|hbo      MTVRLKDFYADWCGPCKTQDPILDELEEEY-ADVEFEKVDVDEEQDVANEYQVRSLPTLI
12110|gene|hma      MTVTLKDFYADWCGPCKTQDPILEDLEEEW-ADVEFEKINVDEEQDVANEYQVRSLPTLI
2600|gene|hhi       MTVTLKDFYADWCGPCKTQDPILEDLEEDW-TDVEFEKINVDEEQDVANEYQVRSLPTLI
                    *:* * **:**********:***:::: :    . : .::*:  :*:**:*:***:**::

1323|gene|hwa       IEN-DDGVVDRFIGVTQREDIETAIQQAL-
326|gene|hut        IEN-DDGVVERFIGVTQGGDIEDALEEAAA
372|gene|hla        IEN-DEGVVDRFVGVTQREDIEAALSEAGA
2600|gene|nrc1      VEN-DDGVVERFVGVTQREQLEDAIESAGA
1310|gene|nph       VEN-DDGIVERFVGVTQRDDLEDALDEAGA
438|gene|hvo        VENDDDGIVDRFVGVTQRDDIESALSQAGA
27560|gene|hbo      IEN-DDGIVDRFVGVTQREDLEDALQKAGA
12110|gene|hma      IEN-DDGIVERFVGVTQADDIDDALQQASA
2600|gene|hhi       IEN-DDGIVERFVGVTQADDIDDALQQASA
                    :** *:*:*:**:****  ::: *:..*