HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0702COG2106KOG3925arCOG04069Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0702 nrc1 VNG1688 vng1688 no entry
cHOG0702 hmu HMUK1827 Hmuk_1827 Protein of unknown function DUF171
cHOG0702 hma RRNAC1612 nucleic acid methylase
cHOG0702 hwa HQ2843A rpl operon protein
cHOG0702 hla HLAC2450 Hlac_2450 Protein of unknown function DUF171
cHOG0702 hbo HBOR10220 Hbor_10220 uncharacterized conserved protein
cHOG0702 hut HUTA2291 Huta_2291 Protein of unknown function DUF171
cHOG0702 hvo HVO_2565 HVO_2565 conserved protein
cHOG0702 nph NP4852A rpl operon protein
cHOG0702 hhi 2155 HAH_2155 nucleic acid methylase
MUSCLE (3.6) multiple sequence alignment


2450|gene|hla       MRTEDGLTICVPSSVVREAEDAREATRKLGYVARAAAVFRADRLVVFPDREG-ERRRGGE
1688|chp|nrc1       ----MTRSVLVPSSLVREAEDKREATRKLGYVARAAAVFRIDRVVVFPDEDG-ERQWGGG
2843|gene|hwa       ----MTLSVLIPSSVVREAEDKREATRKLGYIARSATVFRVDHLIVFPDRGG-ERRLGGE
10220|hp|hbo        ----MTLSVLVPSSLVREAEDKREATRKLGYVARAATVFRADRLIVFPDREG-ERRWGRK
4852|gene|nph       ----MTRSVLVPSSLTREAEDKREATRKLGYVARAATVFRVDRLVVYPDRDGDDGRFGDG
11612|gene|hma      ----MTTSVLVPSSLAREAEDRREATRKLGYVARAAAVYRVDRLTVYPDPDG-AGKWEDG
2155|gene|hhi       ----MTTSVLVPSSLAREAEDRREATRKLGYVARAAAVYRVDRLTVYPDPDG-AGKWEDG
2291|hp|hut         ----MTLNALVPSSLCREAEDKREATRKIGYVARAATVFRVDRLIVYPDPDG-AGRWGDG
                           .  :***: ***** ******:**:**:*:*:* *.: *:**  *   .    

2450|gene|hla       YVRTVLGYAATPPELRKDLWGERDELRYVGVLPPLRVPWRTGSTPSGEESKTQGLVTEVG
1688|chp|nrc1       FVETVLRYAATPPYLRKEAFDTRDELAYAGVLPPLRLSSWTGSDSSGSGSLRQGIVTQVG
2843|gene|hwa       FVETVLRYAATPPHLRKKIWGRRDELEYVGVLPPLRVSSTTGSESTDSGSLTQGIVTEVG
10220|hp|hbo        FVETVLRYAVTPPYLRKEVWGHRDELEYVGVLPPLLVSSTTGSESDDSGSLQQGIVTEVG
4852|gene|nph       FVSTVLEYAATPAYLRKEVWDRRGELEYAGILPPLRVRSQTGSGSDGSGSLRQGIVTEVG
11612|gene|hma      FVETVLRYAATPPHLRKEMWGKRDELEYVGVLPPLRVRSQTGSGSEGSGSLRQGIVTEVG
2155|gene|hhi       FVETVLRYAATPPHLRKEMWGKRDELEYVGVLPPLRVRSQTGSGSEGSGSLRQGIVTEVG
2291|hp|hut         FVETVLRYAATPPYLRKEAWERRDELGCVGVLPPLRVATQTGSGSDDSGSLRQGIVTEVG
                    :* *** **.**. ***. :  *.**  .*:**** :   *** . .. *  **:**:**

2450|gene|hla       PEGRVRVNSPLREHPISLLVPSGMEVEQGERVTIRVSSREPVRARITGKPEEGFQVVEAD
1688|chp|nrc1       SEGRVRVNCGM-QHPISLHEPPGMAVSEGERVTIRVSSRRPVRAKLVDDPLPGFSVERTG
2843|gene|hwa       PDDRVRVNCEL-QHPVSLHVPESVSVREGTRVAIRISSREPVRARIVDTPLSGFDVSCLD
10220|hp|hbo        PDGRVRVNCGM-QHPISLYTPSDMMVKEGERVAIRISSREPVRARIVDEPVPGFDVSRMD
4852|gene|nph       PDGRVRVNCGM-QHPISLPVPPSMEVGKGERVTIRVSSREPVRAKLVDESPPGFAVDCAT
11612|gene|hma      ADGRVRVNCGM-QHPISLPVPADMDVEQGERVTVRVSSRRPVRAKLVDAPTTGFDVVAAD
2155|gene|hhi       ADGRVRVNCGM-QHPISLPVPADMDVEQGERVTVRVSSRRPVRAKLVDAPTTGFDVVAAD
2291|hp|hut         SDGRVRVNCGM-QHPISLAVPGDRTIKEGERVTVRISSRRPVRAKIVDQPPPGYQVDRAN
                    .:.*****. : :**:**  * .  : :* **::*:*** ****.:.. .  *: *    

2450|gene|hla       LSEALAGD--GLAVATSRHGEELSVSRLGDIVSDARKAGGYTVAFGSPERGLPEMLG---
1688|chp|nrc1       LGDALDRSDAGVRIATSRHGEPLSVASLGGYRERIARDGV-TVAFGAPERGLPPMLG---
2843|gene|hwa       LVDALEHAAAGITVATSRHGDTVTTGRLPELAARVNRAGA-TIAFGAPGRGLPVILGDDN
10220|hp|hbo        LEEALGRADAGITIATSRFGESLTVPKLADLSPRIEREGA-TVVFGSPGRGLPDILG---
4852|gene|nph       IEASLARPDAGVRIAASRHGETLSVDRLDGIVGRTTANGF-TVAFGAPERGLPEILG---
11612|gene|hma      LDAALSRDDAGLTIASSRYGEPVTSTRLGQLAERRDAEGGMTVAFGAPERGLPSILD---
2155|gene|hhi       LDAALSRDDAGLTIASSRYGEPVTSTRLGQLAERRDAEGGMTVAFGAPERGLPSILD---
2291|hp|hut         LDAALSRPDAGVRIAASRHGQSLTTERLGRLAGTIASAGDMTVAFGAPERGLPAILG---
                    :  :*     *: :*:**.*: ::   *          *  *:.**:* **** :*.   

2450|gene|hla       ------------LSPDGI------------------RAAVADGRSVEPDPGFDLWLNTIP
1688|chp|nrc1       ------------VSADAV------------------NESVTDSSADAPA-RFDAWLNTIP
2843|gene|hwa       APDSQTQTDEKTVSPANVDTT--------------GDNTASEVVEPNVDPGFDLWLNTIP
10220|hp|hbo        ------------IDAEEV----------------------TVEPSDGP--GFDLWLNTIP
4852|gene|nph       ------------CEP------------------------REEAIGDEPEARFDLWLNTVP
11612|gene|hma      ------------VAPDAV---------------------GGDQTSDEPE-GFDLWLNTVP
2155|gene|hhi       ------------VAPDAV---------------------GGDQTSDEPE-GFDLWLNTVP
2291|hp|hut         ------------VEPGAVDPSTVDELAAAVDAAERNDETVTGSGSDGP--RFDLWLNTVP
                                  .                                    ** ****:*

2450|gene|hla       AQASEVVRTEEALFVTLGSLTLTE
1688|chp|nrc1       DQGSEVVRTEEAVLATLGSLTLTE
2843|gene|hwa       QQGSEVVRTEEAMFASLALLTITE
10220|hp|hbo        RQGSEVVRTEEAMFASLASLTLTE
4852|gene|nph       NQGSEVVRTEEALFATLAPLTLE-
11612|gene|hma      NQGSEVVRTEEALFASLTCLTLTE
2155|gene|hhi       NQGSEVVRTEEALFASLTCLTLTE
2291|hp|hut         NQGSEVVRTEEAMFATLGPLTLTE
                     *.*********::.:*  **: