HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0701COG3612arCOG04418Uncharacterized protein conserved in archaeahypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0701 nrc1 VNG1670 vng1670 no entry
cHOG0701 hmu HMUK1798 Hmuk_1798 conserved hypothetical protein
cHOG0701 hma RRNAC1512 hypothetical protein
cHOG0701 hwa HQ3310A hypothetical protein
cHOG0701 hla HLAC2292 Hlac_2292 hypothetical protein
cHOG0701 hbo HBOR08030 Hbor_08030 uncharacterized conserved protein
cHOG0701 hut HUTA0919 Huta_0919 conserved hypothetical protein
cHOG0701 hvo HVO_2372 HVO_2372 conserved hypothetical protein
cHOG0701 nph NP1728A hypothetical protein
cHOG0701 hhi 2082 HAH_2082 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1670|chp|nrc1      --MSLRVATAAPFKQKGRTQVAEQAFVVALSLDREWMSADQAKRLLDMADAEGLVERVAD
919|chp|hut        --MSLRTAVAAPFVQAGSDQLPRSDFVVDLSLDRDWFSPEQAKRLIDVAEGEGLLTA-SD
3310|hp|hwa        --MSLQIAVAVPFKQRGTTRLGEGAFVVALSLDRSWFSPDQVQRLITIAASRGLLSQ-SD
2292|hp|hla        --MSLEAAVAMPFKQRATEQLGEGEFVVALSLDRDWFSPDQAKRLVDVAVGRGLVTE-ED
8030|hp|hbo        MDMSLDVAVAVPFKQRGTDQLGEGEFVVALSLDRDWFSPDQAKRLIDVAAGRGLVSR-DD
1728|hp|nph        --MSLRTAVAAPFREEGARKMGESAFVVALSLDRDWFSPDQAKRLVDVAASEGLLER-AD
11512|hp|hma       -MMSLKTAVAAPFRQRGTDRMAESEFVVALSLDRNWFSPDQAKTLVDVAASEGLVER-DD
2082|hp|hhi        --MSLKTAVAAPFRQRGTDRMAESEFVVALSLDRNWFSPDQAKTLVDVAASEGLVER-DE
                     ***  *.* ** : .  .:    *** *****.*:*.:*.: *: :* . **:    :

1670|chp|nrc1      GDVAATFDPGAVEIPEGFVPDASLFQERSGFERALDALVAAGFDRQETVAAVNDLQQAVG
919|chp|hut        GTLKLTFESASVTIPDGYQPDESILRKRSTFERVLDTVVAEGTDKQQAVAAINGLQSDLG
3310|hp|hwa        DKVIAEFDPATVSIPESYEPDESILREQSAFEQLLDVLVTAGYEKREAVAEINERQRQLA
2292|hp|hla        GDLVAKFDPADVTVPEDFTPDESILREQSTFETALDAIVAAGVEKQRAVAGINERQRALA
8030|hp|hbo        GNVVAEFDPAGVTVPEDYEPDQSILREQSAFERILDALVADGHDKQSAVADVNDVQRRLG
1728|hp|nph        GDLVASFDPASTTVPEDFAPDESLLQERSTFERVLDELVESGTEKQDAVAGINQLQSELG
11512|hp|hma       DDLVVAFDATHTAIPDGFTPGEEILQSRSTFERVLDAVIEAGIEKQTAVAGINALQSDIG
2082|hp|hhi        DDLVVAFDATHTTIPDGFTPGEEILQSRSTFERVLDAVVEAGIEKQTAVAGINALQSDIG
                   . :   *:.  . :*:.: *. .::...* **  ** ::  * :.. :** :*  *  :.

1670|chp|nrc1      VTADAAAVVYARQQGVAASGAAEAAQEGV------------------------LDGR
919|chp|hut        VTLETAAILYARRQGIDVDEAIDRTLEAL----------------------------
3310|hp|hwa        ISVEAAAAVYATEVGLDLDTNGGSAIDMA---------------------YNSLCSE
2292|hp|hla        VSIEAAAVLFAKEHGAAVDHLAADVREKLAAAGDAAGDADGEGDTGADATTGAAEAE
8030|hp|hbo        VSVEAAAALYAKQHGVEVGDAAQKAREEL----------------------------
1728|hp|nph        VTIEAAAVLYAHEHGLDVDDYAATARAEL----------------------------
11512|hp|hma       VTLEAAAVVYARSEGVDVEAIAADVREEL----------------------------
2082|hp|hhi        VTLEAAAVVYARSEGVDVEAIAADVREEL----------------------------
                   :: ::** ::*   *         .