HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0700COG2139KOG1732arCOG04129Ribosomal protein L21E50S ribosomal protein L21E

HOG Organism Gene ID Name Annotation
cHOG0700 nrc1 VNG1170 rpl21e 50S ribosomal protein L21E
cHOG0700 hmu HMUK2674 Hmuk_2674 Ribosomal protein L21e
cHOG0700 hma RRNAC0260 rpl21E 50S ribosomal protein L21e
cHOG0700 hwa HQ2896A rpl21R 50S ribosomal protein L21e
cHOG0700 hla HLAC2277 Hlac_2277 Ribosomal protein L21e
cHOG0700 hbo HBOR12170 Hbor_12170 LSU ribosomal protein L21E
cHOG0700 hut HUTA0624 Huta_0624 Ribosomal protein L21e
cHOG0700 hvo HVO_2749 HVO_2749 Ribosomal protein L21e
cHOG0700 nph NP3684A rpl21R 50S ribosomal protein L21e
cHOG0700 hhi 1004 rpl21E 50S ribosomal protein L21e
MUSCLE (3.6) multiple sequence alignment


1170|gene|nrc1      ----MPNSNGPLSNSGGKLQNDPRDRGTSPPQRAIADYDDGESVHLTLDPSVQDGRFHPR
3684|gene|nph       ----MPSSNGPRQATRNKLKNDARERGTSPPQRSIEEYDDGEKVHLKLDPSVPNGQFHPR
10260|gene|hma      ----MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPR
1004|gene|hhi       ----MPSSNGPLEGTRDKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPR
2277|gene|hla       MPKTMPSSNGPQKATRDKLSNKPRDRGTSPPQRAIQEFDEGSQVHLKIDPSVQKGRFHPR
624|gene|hut        ----MPSSNGPLEGTRNKLKNDPRDRGTSPPQRAIQEFDVGTSVHLDIDPSVADGRFHPR
2896|gene|hwa       ----MPSSNGPMTGTRDKLSNSPRERGMSPPQRAIQEYDEGQKVHLRIDPSVREGRFHPR
12170|gene|hbo      ----MPSSNGPLHGTRGKLSNKPRERGTSPPQRAIQEYDEGQKVHLKIDPSVRKGRFHPR
                        **.****   : .**.*..*:** *****:: ::* * .*** :**** .*.****

1170|gene|nrc1      FSGLTGTVVGTQGDAFKVEVNDGGMDKTLIVGAAHLRTQRQEE
3684|gene|nph       FNGRTGTVVGEQGDAFKVEIEDGNVTKTVIAAPAHLRRQQA--
10260|gene|hma      FDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE---
1004|gene|hhi       FDGQTGTVEGKQGDAYKVDIVDGGKAKTIIVTAAHLRRQE---
2277|gene|hla       FDGRTGTVLGKQGAAFKVEIPDGGKTKTLIVTAAHMSAQQN--
624|gene|hut        FSGHTGEVIGEQGTAYKVQINDGGKDKTIIVKPAHLREQTEE-
2896|gene|hwa       FNGHTGEVTGKQGRAFKIKIIDGGKEKTLIARPAHLRAQE---
12170|gene|hbo      FNGHTGEVIGKQGRAFKVQINDGGKDKTLIVRPAHLRAQQ---
                    *.* ** * * ** *:*:.: **.  **:*. .**:  *