HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0007COG1131arCOG00194 ABC-type multidrug transport system ATPase component copper transport ATP-binding protein

HOG Organism Gene ID Name Annotation
cHOG0007 nrc1 VNG2378 nosF1 copper transport ATP-binding protein
cHOG0007 hmu HMUK2940 Hmuk_2940 ABC transporter related
cHOG0007 hmu HMUK1082 Hmuk_1082 ABC transporter related
cHOG0007 hma RRNAC1655 nosF-2 ABC transporter ATP-binding protein
cHOG0007 hma RRNAC3053 ABC transporter ATP-binding protein
cHOG0007 hwa HQ1145A nosF ABC-type copper transport system involved in multi-copper enzyme maturation, ATP-binding protein
cHOG0007 hwa HQ3696A nosF ABC-type copper transport system, ATP-binding protein
cHOG0007 hla HLAC2644 Hlac_2644 ABC transporter related
cHOG0007 hbo HBOR02400 Hbor_02400 ABC-type multidrug transport system, ATPase component
cHOG0007 hbo HBOR29680b Hbor_29680 ABC-type multidrug transport system, ATPase component
cHOG0007 hbo HBOR30280b Hbor_30280 ABC-type multidrug transport system, ATPase component
cHOG0007 hbo HBOR31180b Hbor_31180 ABC-type multidrug transport system, ATPase component
cHOG0007 hbo HBOR33850b Hbor_33850 ABC-type multidrug transport system, ATPase component
cHOG0007 hbo HBOR36990b Hbor_36990 K+dependent Na+ exchanger related-protein
cHOG0007 hbo HBOR37080b Hbor_37080 predicted oxidoreductase, aryl-alcohol dehydrogenase like protein
cHOG0007 hbo HBOR38960b Hbor_38960 K+dependent Na+ exchanger related-protein
cHOG0007 hbo HBOR39050b Hbor_39050 predicted oxidoreductase, aryl-alcohol dehydrogenase like protein
cHOG0007 hut HUTA2631 Huta_2631 ABC transporter related
cHOG0007 hut HUTA2635 Huta_2635 ABC transporter related
cHOG0007 hut HUTA0892 Huta_0892 ABC transporter related
cHOG0007 hvo HVO_3002 HVO_3002 nosF ABC transporter ATP-binding protein
cHOG0007 nph NP1082A abc25a copper ABC transporter ATP-binding protein
cHOG0007 nph NP1198A abc26a copper ABC transporter ATP-binding protein
cHOG0007 hhi 2196 nosF2 ABC transporter ATP-binding protein
cHOG0007 hhi 308 HAH_0308 ABC transporter ATP-binding protein
MUSCLE (3.6) multiple sequence alignment


36990|gene|hbo      MIQTGQAVQVGIVVVSVAGLWIGARL--------------------LVDSVVRLARRVGL
37080|hp|hbo        ---------MHQNESDTFD--IGGDL--------------------TVHRLGFGAMRITG
38960|gene|hbo      --MTETTPTTDSAAIRLTD--VTRTF------------------G-DVTAVNELDMRVSR
33850|gene|hbo      ---MTDAPNHGTPAVVTDG--FTKRF------------------G-SVTAVKELRMTVPA
1145|gene|hwa       -----------MSAIDARD--ISKRY------------------G-TVTALDRVSLTVES
29680|gene|hbo      -----------MNPIETHS--LTKRY------------------G-ETTALDSLEMSIEN
31180|gene|hbo      -----------MTAIDITN--FTKEY------------------K-STTAVDGLNLSVKE
39050|hp|hbo        -----------MTVIQTTE--VSKRY------------------G-GESAVVDLDLTVED
30280|gene|hbo      -------MSDPTPTIQTDA--LTKQY------------------G-DIRAVDNLDLTVES
11655|gene|hma      -------------------------------------------------------MTVAQ
2196|gene|hhi       ---------MTPPAIETDE--LSKQY------------------G-ETVALDALNMTVAQ
892|gene|hut        -----------MTAIEIDG--LGKEY------------------G-DLTALDGLDLSVET
1198|gene|nph       -----------MPALQLES--VHKRF------------------G-DVVALDDVSFSVPD
3696|gene|hwa       -----------MSAIEFDG--VTKVF------------------D-DITAVSDLSLRIET
2631|gene|hut       -----------MVAIDLTD--VTKTY------------------G-DVTALQSVDLTVED
2378|gene|nrc1      -----------MPAIELSG--VSKRY------------------G-DVTALTDLNITVDE
1082|gene|nph       -----------MAAIELDG--VEKAY------------------G-DVQALSGVDLEVEE
2644|gene|hla       -----------MTAIELRG--VTKEF------------------A-DVTAVRGLDLTVEE
2400|gene|hbo       -----------MAAIELDR--VTKRFEEGGRVSHLLDSIRGADGSKGVTAVRDLSLTVEE
13053|gene|hma      -----------MAAIELDG--VTKQF------------------G-SLTALQGVDLTVEE
308|gene|hhi        -----------MAAIELDG--VTKQF------------------G-SLTALQGVDLTVEE
2635|gene|hut       -----------MPAIETNE--LGKRF------------------GDDIFALDGVDLRVKE
                                                                             :  

36990|gene|hbo      SELTIGLTVVAAG----TSTPELVV------TADAALVGLGDIAVGNVVGSNIYNLAFIL
37080|hp|hbo        ENIIGKPDDEENAKRVLQTAVNLGVNLIDTADS------YGPGVSERLIREALAPYPE--
38960|gene|hbo      GEIYGFLGPNGAGK---TTTIGMLVNFLRPSSGRVRVFGHDPQTDELTIKNRTGILSEGF
33850|gene|hbo      GSVYGLLGPNGAGK---STTIDALVGLVHATEGTVRVLGLDIRTSPVEIRRRTGILPDGF
1145|gene|hwa       GEIFGFLGPNGAGK---STFLNLMLGFTHPSAGSISVFDYDCQHEGVMARERIGVLPEGY
29680|gene|hbo      GEVFGFLGPNGSGK---STTIDILLGFIYPTSGSASVFGIDPTENATAIRQRTGVVPDGY
31180|gene|hbo      GEVYGFLGPNGAGK---STTIDALMNYIQPTSGQIEIFGLDAREDASQVHSRVGILPDQF
39050|hp|hbo        GVVYGFLGPNGAGK---STTIDMLMNYTRPSAGSITVLGLDAQEDASEIHARTGILPDQF
30280|gene|hbo      GEIYGFLGPNGAGK---STTIGMLLDYLRPTSGTMRVFGQDPQTDAVKIHERIGVLPDRF
11655|gene|hma      GEVYGFLGPNGAGK---STTINLLMDYIKPTSGTARVLGHDPWNDVVACHQRVGICPDRF
2196|gene|hhi       GEVYGFLGPNGAGK---STTINLLMDYIKPTSGTARVLGHDPWNDVVACHQRVGICPDRF
892|gene|hut        GEVYGFLGPNGAGK---STTINLLLGFLDPSSGSATVLGHDIERESRALRRRIGVLPEAF
1198|gene|nph       GEVFGFLGPNGAGK---STTIDIVLDYVRPTDGSVSVFGHDAQADPTAVHARTGVLPDAT
3696|gene|hwa       GEVFGFLGPNGAGK---STTINMLLDFVRPTTGTVTALGVDAHTDSVAVRRRTGVLPEGF
2631|gene|hut       GEVFGFLGPNGAGK---STTIDILLDHARPTAGHAEVLDMDAQDETVAVRERTGVLPERF
2378|gene|nrc1      GEIYGFLGPNGAGK---STAINILLDFVRPTTGSATILGYDAQADSQAIRQRIGVLPEGF
1082|gene|nph       GEIFGFLGPNGAGK---STTINILLDFVRPDAGSVRVLGYDAGEESVAVRERTGVLPEGF
2644|gene|hla       GEVYGFLGPNGAGK---STTIDMVLDLVRPTEGTVRVLEQDATTDGVAIRKRTGVLPDGF
2400|gene|hbo       GEVFGFLGPNGAGK---STTINMLLDFVRPTEGTISVLGFDANDQSVDVRARTGVLPEGF
13053|gene|hma      GEIFGFLGPNGAGK---STTINILLDFVRATDGSATVLGHDIHEEPKRIRARTGVLPEGY
308|gene|hhi        GEIFGFLGPNGAGK---STTINILLDFVRATDGSATVLGHDIHEEPKRIRARTGVLPEGY
2635|gene|hut       GEIFGFLGPNGAGK---STTINILLDFVRPTSGSATVLGMDAQDQSQEIRRRTGVLPEGY
                      :         .     :     :       .       .               .   

36990|gene|hbo      GVVSLLRVVPIERSLVHRDGV----------------------AL--LVSTFLGVYAISD
37080|hp|hbo        ------------ELVVATKGG------------------------------LL-------
38960|gene|hbo      TPYPKLSGLRHVELACQLHN-----------------------ED--EPLGYLERVGLAD
33850|gene|hbo      TPYERLTGREHLDAAACANGV----------------------TV--DTDEALARVGLAD
1145|gene|hwa       DVIDHLTGRQHIEYAIEAKQI----------------------DDNADPLNVLDRVGLTE
29680|gene|hbo      EVMPDWTGRDHVEFELDSRNV----------------------DD--DPDALLDRFGLLE
31180|gene|hbo      DVYARLTGRQHIEFVANTKGV----------------------DI--NTDTLLNRVGLED
39050|hp|hbo        GVYSTLTGREHVRYVLDANDA----------------------TG--NPEAVLDRVGLGD
30280|gene|hbo      GLYEDRTARQHVRFITEMKQS----------------------DD--DPETLLERVGLSD
11655|gene|hma      ETYESLSARRHLELVIDTKRA----------------------DD--DPRALLERVGLVD
2196|gene|hhi       ETYASLSARRHLELVIDTKRT----------------------DD--DPRALLERVGLAD
892|gene|hut        SPYERLTAREHVKYAADLKDV----------------------AV--DPDVLLDRVGLTE
1198|gene|nph       ALAGHLTATEHVRFAIDSKGA----------------------DD--DTDALLERVGLDG
3696|gene|hwa       DVYNRLSGRAHIEFAIDSKEA----------------------DV--TPAVILDRVGLTD
2631|gene|hut       GPLGEMTGRQHVEFTVEAKNA----------------------DD--DPGRIVERVGIDH
2378|gene|nrc1      SVYDRLTARKHVEFAIDSKNA----------------------TN--DPDALLDRVGIPE
1082|gene|nph       SVYDRLSAREHVAFAVDSKDA----------------------DD--DPEALLERVGLED
2644|gene|hla       AVYDRLTGRQHVEFAVRSKEA----------------------DD--DPDALLDRVGLLD
2400|gene|hbo       DVYERLTGREHVEFAASSKGVEMAAAATTESEGETMESEESVGEE--KVDAVLDRVGLAA
13053|gene|hma      DVYDRLTGRQHLSFVIESKDA----------------------DE--DPDELAERVGIAD
308|gene|hhi        DVYDRLTGRQHLSFVIESKDA----------------------DA--DADELAERVGIAD
2635|gene|hut       QVYGRLTGRQHVQFVIDSKKV----------------------DD--NPDALLERVGIPE
                                                                                

36990|gene|hbo      SVVTRGEGAVLVGLFVAYIAFLLRSGITDEMSADADA----PPGVTT--TVTERIQFRGR
37080|hp|hbo        ---RNRDGDWLPH------------GDPDYL-RNAHLCSLDRLGVESID--LYQLHRRDP
38960|gene|hbo      DA-EQKAGGYSRGMTRRLGLAMALVGDPDLLILDEPIAGLDPLGAARVKEIIEEENTKGA
33850|gene|hbo      AA-DRTAGGYSRGMSQRLGLAMALVGAPDLLVLDEPAAGLDPHGIKLLRRIIREEHARGA
1145|gene|hwa       DA-GRMATEYSKGMKQRLVLGMALTGEPDLLLLDEPTAGLDPTGAAELRSIIREENERGA
29680|gene|hbo      DA-DRVATGYSRGMRQRLLLSMAAAGEPDLLLLDEPTTGLDPNGIRLMREFIRDERARGA
31180|gene|hbo      AK-DSPAQSYSKGMQQRLGLAMALVGDPDLLILDEPFSGLDPFGTQLVRDIVMTQTNRGT
39050|hp|hbo        AI-DQRAGGYSKGMQQRLGLAMAIAGEPELLILDEPFSGLDPYGVRLVRDVVEAERDRGA
30280|gene|hbo      AI-DDDTSEYSHGMEQRLALAMSLVGNPDLLILDEPFNGLDPHGVRRVREIVHEENERGA
11655|gene|hma      AI-ERPAGEFSQGMEQRLALAMSLVGQPDLLILDEPFTGLDPHGVALVRDVVEAESERGA
2196|gene|hhi       AI-ERPAGEFSQGMEQRLALAMSLVGEPDLLILDEPFTGLDPHGVALVRDVVEAESERGA
892|gene|hut        DAWDRSAGGFSTGMEQRLALACALVGDPEVLILDEPSSGLDPRGMAELRELIREEAADGT
1198|gene|nph       VG-DRRVGGFSKGMRQRLLLATALVGEPELLILDEPSTGLDPNGARRMREIVREENDRGA
3696|gene|hwa       AA-DRPAGGYSKGMQQRLALGMALSGDPDLLILDEPASGLDPAGTKAMRDIVRKEADSGT
2631|gene|hut       AA-DRPASGYSKGMTQRLMLGMALVGEPDLLILDEPTTGLDPNGARQMREIVRAEAERGA
2378|gene|nrc1      AA-DRKAGGFSTGMRQRLGLAIALVGDPEMLLLDEPSSGLDPNGAREMRSILTEEANRGT
1082|gene|nph       DA-GRKAGGFSTGMRQRLALAMALAGDPDLLVLDEPSSGLDPNGARELREIVEDEAENGA
2644|gene|hla       DA-DRKAGGYSKGMRQRLALAMALAGDPDLLILDEPSSGLDPAGAKEMREIVRAEADRGA
2400|gene|hbo       AA-DRKAGGYSKGMRQRLALAMALIGDPDLLILDEPSSGLDPAGAKEMRDIVVEEAERGT
13053|gene|hma      AI-DRKAGGYSKGMQQRLVLAMALVGEPDLLILDEPTTGLDPNGARLMRELIREENERGA
308|gene|hhi        AI-DRKAGGYSKGMQQRLVLAMAIVGKPDLLILDEPTTGLDPNGARLMREIIREENERGA
2635|gene|hut       AA-DRKAGEYSKGMKQRLTLAMALVGEPELLILDEPSTGLDPAGAREIREIVREEAERGA
                                             * .: :  :         *              . 

36990|gene|hbo      DVVLLVAGLAIVLISGDLMVGSASELARGAGVSEWVIGGTIVAAGTSTPEFAVSL-----
37080|hp|hbo        DVDFEASVTALAELKDEGVIEHIGLSN----VSVEQLETARDIVDVATVQNKFNL-----
38960|gene|hbo      TVFFSSHQLGHV----QAVCDRVEIIKDGSLVREAQMEELLGQANEGPT-IRINV-----
33850|gene|hbo      TVLLSTHQLAQV----EAVCDTVGIIDDGQLVAEDSAEALRRTVGTETT-LRIRL-----
1145|gene|hwa       TIFFSSHVLEQV----EAVCDRVGILQNGTLIAVDTIQGLRGSLGGGTK-LEITV-----
29680|gene|hbo      TIFFSSHRLAQV----ESVCDRVGILNEGSLLAIDSIDSLRNAVGDNTI-LQVSV-----
31180|gene|hbo      TVFFSSHVLEQV----ERVCGRIGLLDDGQLVAEGKPREIRASADVKPR-LVVAL-----
39050|hp|hbo        TVFFSSHVLDQV----ERVCDQVGLLANGHLIAEGTPTELRDIAGVQTR-LCIET-----
30280|gene|hbo      TVFFSSHVLGQV----EIVCDRIGILHDGQLVAEGNVSELQDAAETDD------------
11655|gene|hma      TVFFSSHVLGQV----DLVCDRVGILYEGDLIVEGTLPALRDTCDLSS------------
2196|gene|hhi       TVFFSSHVLGQV----DLVCDRVGILYEGDLIVEGTLPALRDTCDLSS------------
892|gene|hut        TVFFSSHILSEV----EAVCDRIGILVDGGLVAEGTIDELRDGTETHSP-LDVRV-----
1198|gene|nph       TVLFSSHILEQV----EAVSDRVGILADGELVACDSIDGLRGRLGSKAR-LSVTV-----
3696|gene|hwa       TVFFSSHVLEQV----EAVCDRVGIMQAGELIAVDSIDGLRETADVETV-VSLTL-----
2631|gene|hut       TVFFSSHILQQV----EAVCDRVGILDYGNLVAVDSIDGLREAAGTTGE-MTVTL-----
2378|gene|nrc1      TVFFSSHILGQV----EAICDHAGILQNGTLVAEDSIDALREATDATTT-LTVTL-----
1082|gene|nph       TVFFSSHILGQV----EAVCDRVGIIRNGEVVATDSISGLRDAVGDGST-LVVEV-----
2644|gene|hla       TVFFSSHILEQV----EAVCDRVGILREGELVTEDSVEGLREAVGGEET-LEIAISGGGA
2400|gene|hbo       TVFFSSHILEQV----EAVCDRVGILRDGELVAVDTIDSLREKSNADST-LNVRV-----
13053|gene|hma      TVFFSSHILGQV----EAVCDTVGILQNGRLIAKDSVAGLREAAAGDTV-LRVTL-----
308|gene|hhi        TVFFSSHILGQV----EAVCDTVGILQNGRLIAKDSVAGLREAAAGDTV-LRVTL-----
2635|gene|hut       TVFFSSHIMEQV----EAVCDRVGILRAGELVAVDSIDGLREAAGDGAT-LRVEL-----
                     : :       .    : :            :                            

36990|gene|hbo      -------------VAMRRGRLGVSVGNVVGSNVFNLLVIMGVGAVIRPLSLSGSIG----
37080|hp|hbo        ------GHREDDDVLAACEEYDIGFIPW------FPLAAGELDEKVDVLESVAENHDATE
38960|gene|hbo      ------NSTPERVPETVEMIDGVTDAWISESD--ICVKCSRTDVRSDVVIALSEAG----
33850|gene|hbo      ------AGSLDRASDLLHDLDGVAGVTAEGGA--LIVRCDAEQDTAGVIAELERSD----
1145|gene|hwa       ------DSLQNGTLNTIQEIEGVETAVTPDNST-IEATCTN-DAKMDILVGLRDAG----
29680|gene|hbo      ------DHVPDD-IDSLTTLDGIENLEVSGTT--LRVQCAH-GRHLDALNHLDRLG----
31180|gene|hbo      -------AQPKKGLTEVQDIDSVSDVNIDGDGY-LSVVSESAHVFTTVLNRLDSTN----
39050|hp|hbo        -------ADEDLAVEGIRDFDGVEDATYDAGE--IVVTCPR-TACYQVLRRLEGAG----
30280|gene|hbo      ------------------------------------------------------------
11655|gene|hma      ------------------------------------------------------------
2196|gene|hhi       ------------------------------------------------------------
892|gene|hut        ------DAVPEGF--DLTDLDGVASMSVEDST--LSALVTDAGAKIEVIRRVDQV-----
1198|gene|nph       ------DELSDAAIEAVEALDGVVDVSVTGRT--VAAACPD-DRKAAVVDAVRTDG----
3696|gene|hwa       -----DTGDVDTAVDMISDIEGVDTVMQSGSQS-IQVSCES-AAKTTVVTKLDTAG----
2631|gene|hut       ------DTVPDRLGDEISAIEGVTSVRVDGYS--IVAGCEN-PAKAAVVEACQQAG----
2378|gene|nrc1      ------DAVTDDAVAAANAIPGVSEVSVDASD--LVVRTGD-ASKTDVLDAIESTG----
1082|gene|nph       ------DTVPDGTEDRLSSLDGVGNIAIDGTT--LRVNCED-GVKTAVVSELEAAG----
2644|gene|hla       DDADDADNTGNAAIEAIRDLDGVSRVNRDGDT--LVVSCAD-GAKTRVIGALEDAG----
2400|gene|hbo       -----AGDVTTVDTDAVTALDGVHSVTVEDGDDKLIVSCAG-DAKTAVIAELESQG----
13053|gene|hma      ----ADGDGTDAAVAAIEGLDEVSTVTADGTT--LTIGCDS-DAKMAVLNAVEESG----
308|gene|hhi        ----ADGDGTDDVIAAIEGIDAVSGVTADGNT--LSVTCDG-DAKMAVLNAVEKNG----
2635|gene|hut       ------ATVTDDAIAVVESVSGVTEVRRRDGG--LTVSVGN-GSKTRVLSALEDAG----
                                                                                

36990|gene|hbo      ------------------LSLTWLV--AVSVAVVAALWTGRRLSRAEGGLFAGSEVIRWV
37080|hp|hbo        YQVMLAWLLQHSPVTLPIPGTSSVEHLKQNIGATRLELTDEEMARLDK------------
38960|gene|hbo      ------------------IEVVDFETETQSLEDVFTAVMD--------------------
33850|gene|hbo      ------------------VTLESYEKSHPGLEQVFEAYTDER------------------
1145|gene|hwa       ------------------IDVVNFRTQEASLEDMFIEYTETDQSHNNNTNHDNADHGVTN
29680|gene|hbo      ------------------ATPQRFETETASLEDIFSAYTESETESSESVVESPVETPL--
31180|gene|hbo      -------------------EIQWFDVEFGTIEDAFIENTNS-------------------
39050|hp|hbo        ------------------VSIRSFDVEQGTIEDAFVELADA-------------------
30280|gene|hbo      ---------------------------DATMEDMFVELTDARAAIGGDSQ----------
11655|gene|hma      ---------------------------DATVEDIFMTLTDGSAHATEVDA----------
2196|gene|hhi       ---------------------------DATVEDIFMTLTDGSDHAEAVDA----------
892|gene|hut        ------------------AEIRDVISEPASLEALFDRYANGDSAAEGMEDADGSSDDADG
1198|gene|nph       ------------------ATVEDIETGEASLEELFAAYTGESQ-----------------
3696|gene|hwa       ------------------IDVTDFETESASLEDLFLSYTDDNHTVDSATTKRATNRSTDI
2631|gene|hut       ------------------ATVENIETSEASLEDLFAAYTGGA------------------
2378|gene|nrc1      ------------------ATVQDFATEDASLDDVFSAYTTEEMPA---------------
1082|gene|nph       ------------------ATVEDFSTEEASLEELFAAYTEGQR-----------------
2644|gene|hla       ------------------IAVADFHTREASLEDLFLAYTEGDAPGADGGDPDERAGEEPE
2400|gene|hbo       ------------------LGVADFETREASLEDLFLSYTGHETGGDEDSTVDETNTEQEV
13053|gene|hma      ------------------SEVANFETEEASLDEVFAAYTEQQEQDRPEADV---------
308|gene|hhi        ------------------HEVANFDTEEASLDEVFAAYTETEQSQQEVDA----------
2635|gene|hut       ------------------HEVTDFRTEETSLEEIFMSYTEGSR-----------------
                                                  :                             

36990|gene|hbo      VGLLGLG--------------------------------
37080|hp|hbo        ---------------------------------------
38960|gene|hbo      ---------------------------------------
33850|gene|hbo      ---------------------------------------
1145|gene|hwa       ASGKKKENNHGSQSGEQSEPAEESTAESESGLESGVPSE
29680|gene|hbo      ---------------------------------------
31180|gene|hbo      ---------------------------------------
39050|hp|hbo        ---------------------------------------
30280|gene|hbo      ---------------------------------------
11655|gene|hma      ---------------------------------------
2196|gene|hhi       ---------------------------------------
892|gene|hut        STEEADAGSTEATA-------------------------
1198|gene|nph       ---------------------------------------
3696|gene|hwa       STGSSETDEGTAEQ-------------------------
2631|gene|hut       ---------------------------------------
2378|gene|nrc1      ---------------------------------------
1082|gene|nph       ---------------------------------------
2644|gene|hla       EVDR-----------------------------------
2400|gene|hbo       SA-------------------------------------
13053|gene|hma      ---------------------------------------
308|gene|hhi        ---------------------------------------
2635|gene|hut       ---------------------------------------