HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0699COG1781Aspartate carbamoyltransferase regulatory subunitaspartate carbamoyltransferase regulatory chain

HOG Organism Gene ID Name Annotation
cHOG0699 nrc1 VNG6311d pyrI aspartate carbamoyltransferase regulatory chain
cHOG0699 hmu HMUK2302 Hmuk_2302 aspartate carbamoyltransferase, regulatory subunit
cHOG0699 hma RRNAC1224 pyrI aspartate carbamoyltransferase regulatory subunit
cHOG0699 hwa HQ1878A pyrI aspartate carbamoyltransferase regulatory subunit
cHOG0699 hla HLAC1284 Hlac_1284 aspartate carbamoyltransferase, regulatory subunit
cHOG0699 hbo HBOR17820 Hbor_17820 aspartate carbamoyltransferase, regulatory subunit
cHOG0699 hut HUTA0521 Huta_0521 aspartate carbamoyltransferase, regulatory subunit
cHOG0699 hvo HVO_1455 HVO_1455 pyrI aspartate carbamoyltransferase regulatory subunit
cHOG0699 nph NP3520A pyrI aspartate carbamoyltransferase regulatory subunit
cHOG0699 hhi 1818 pyrI aspartate carbamoyltransferase regulatory subunit
MUSCLE (3.6) multiple sequence alignment


6311|gene|nrc1      ------------------MGVSTMSSDQHLQVSKIQAGTVIDHIPAGQALQVLQILGTNG
521|gene|hut        -----------------------MSDDQELRVSKIRNGTVIDHVNGGASMHVLSILGIEG
3520|gene|nph       ------------------------MTDTELRVSKIQKGTVIDHIAGGQALNVLAILGIDG
11224|gene|hma      ----------------------MSDNDQQLRVSKIQNGTVIDHIAGGQALNVLAILGIDG
1818|gene|hhi       ----------------------MSDNDQQLRVSKIQNGTVIDHIAGGQALNVLAILGIDG
1284|gene|hla       ------------------------MSDHELRVSKIRDGTVIDHVEGGQALNVLAILGIDG
1878|gene|hwa       MNDREPNQKESKESVNDAVPRARKVDDQQLRVSKIRDGTVIDHLTAGEALNVLAILGIDG
17820|gene|hbo      ------------------------MSDKELRVSKIRDGTVIDHLTAGQALNVLAILGIDG
                                              *  *.****. ******: .* :::** *** :*

6311|gene|nrc1      ASDDQITVGMNVTSERHHRKDIVKIEGRELSQDEVDVLSLIAPDATINIVRDYEVDEKRR
521|gene|hut        GDGDTVSIVMNVPSDRLGKKDIVKVEDRELSQAEVDVLSLIAPAATINIIRDFEVIEKRR
3520|gene|nph       TSGDEISVGMNVPSDRLGRKDIVKVEGRELSQNEVDVLSLIAPAATINIVRDFEVIEKHR
11224|gene|hma      TSGDSVSVAMNMPSDRLGHKDVVKVEGRELSQNEVDVLSLIAPAATINIIRDYEVVEKGR
1818|gene|hhi       TSGDSVSVAMNMPSDRLGHKDVVKVEGRELSQDEVDVLSLIAPAATINIIRDYDVVEKRR
1284|gene|hla       SEGYGVSVGMNVPSDRLGRKDIVKVEERELSQSEVDVLSLIAPEATINIVRDFEVVEKNR
1878|gene|hwa       SSGEGVSVGMNVISDRLGRKDIVKVEDRELSQSEVDVLAVIAPEATINIIRDYAVVDKKR
17820|gene|hbo      SGGESVSIGMNVPSDRLARKDIVKVEDRELSQSEVDVLSVISPEATINIVRDYEVVDKKR
                      .  ::: **: *:*  .**:**:* ***** *****::*:* *****:**: * :* *

6311|gene|nrc1      VDRPDVVAGVLSCPNPNCITANDEPVRSGFDVLDDGMRCQYCEQIVSED-IPSLIDPE
521|gene|hut        VARPDEVVGVLSCPNPQCITTEDEPVESRFEVLEDGVRCCYCDTIVRDD-VAELID--
3520|gene|nph       VTRPETVEGVLSCPNANCITTENEPVDSRFEVLEAGVRCSYCGTIIRES-LAAHISVA
11224|gene|hma      VERPSVVEGVLECPNHNCITTENEPVDSRFAVGDDGVRCEYCDTIIRDD-LPAHILAE
1818|gene|hhi       VERPSVVEGVLECPNHNCITTEAEPVDSRFAVGDDGVRCEYCDTIIRDD-LPAHILAE
1284|gene|hla       VTRPDSVTGVLSCPNRNCITNAGEPIDTRFDVVADGVRCDYCSTILRSD-IADYIDV-
1878|gene|hwa       IERPTAVTGLLFCPNRNCITNANEPINTRFIVLDEGLQCDYCGSIVRESEVPTYLDVA
17820|gene|hbo      VERPDEVTGVVSCPNRNCITNADEPVASRFEVLSDGLRCGYCGTIVREDEVASNLDAA
                    : **  * *:: *** :***   **: : * *   *:.* **  *: .. :.  :