HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0698COG0822KOG3361arCOG02077NifU homolog involved in Fe-S cluster formationNifU homolog involved in Fe-S cluster formation

HOG Organism Gene ID Name Annotation
cHOG0698 nrc1 VNG2472 nifU NifU homolog involved in Fe-S cluster formation
cHOG0698 hmu HMUK1252 Hmuk_1252 SUF system FeS assembly protein, NifU family
cHOG0698 hma RRNAC3102 nifU1 NifU-like protein
cHOG0698 hwa HQ3428A nifU homolog to nitrogen fixation protein NifU
cHOG0698 hla HLAC2247 Hlac_2247 SUF system FeS assembly protein, NifU family
cHOG0698 hbo HBOR01150 Hbor_01150 SUF system FeS assembly protein, NifU family
cHOG0698 hut HUTA1226 Huta_1226 SUF system FeS assembly protein, NifU family
cHOG0698 hvo HVO_0107 HVO_0107 SUF system FeS assembly protein NifU family
cHOG0698 nph NP0940A homolog to nitrogen fixation protein NifU
cHOG0698 hhi 353 nifU1 NifU-like protein/SUF system FeS assembly protein, NifU family
MUSCLE (3.6) multiple sequence alignment


2472|gene|nrc1      -----------------MSM-GSDMYRQQILDHYRNPRNQGELPEPSFTHEGYNPSCGDE
940|gene|nph        -----------------MGI-GSDMYRQQILDHYKNPRNYGELEDADIEHVGENPMCGDT
1226|gene|hut       MHSRGTFFGECHVSNDTMGIGGSDMYRQQILDHYKNPRNYGEIEGATFTHVGENPMCGDT
13102|gene|hma      -----------------MGIGGSDMYRQQILDHYKNPRNYGEIEDPTFTHIGENPMCGDE
353|gene|hhi        -----------------MGIGGSDMYRQQILDHYKNPRNYGEIEDPTFTHIGENPMCGDE
2247|gene|hla       -----------------MGL-GSDMYRQQILDHYKNPRNYGELEDPDFTHVGENPSCGDT
3428|gene|hwa       -----------------MGL-GSDMYRQQILDHYKNPRNKGEIPDPDFSHTGENPSCGDT
1150|gene|hbo       -------------------M-GSDMYRQQILDHYKNPRNKGEMEDPTFSHTGENPSCGDT
                                       : *************.**** **:  . : * * ** *** 

2472|gene|nrc1      LEFDVALDDDGETIAHVAFRGDGCAISQASASMLSEELPGMTLAEVDALDRDDILDMLGV
940|gene|nph        IKMFLQLADDGDTIERVSFIGDGCAISQASASMLSEELRGESLEAVREMDRDDIIDMLGV
1226|gene|hut       IEMDVVLDDDEETIEAVAFQGDGCAISQASASMLSERLEGMTIEELEALDRDDVIDMLGV
13102|gene|hma      IRMDVVLDEDEETIEQVAFQGDGCAISQASASMLSQELAGMAVEDLKAMDRDDITEMLGV
353|gene|hhi        IRMDVVLDESEETIERVAFQGDGCAISQASASMLSQELAGMAVEDLEAMDRDDITEMLGV
2247|gene|hla       IQMQVALDDAGETIKAVRFTGDGCAISMASASMLSERLHGMSIEELDALDTDDITEMLGV
3428|gene|hwa       ITVNVQLKDDNETIEYVSFTGDGCAISQASASMLSEHLQGMTLEELDTLDTDDVTEMLGV
1150|gene|hbo       ITMQVKLEDDDETIEFVAFTGDGCAISQASASMLSERLQGTTLSELEEMDTDDVTEMLGV
                    : . : * :  :**  * * ******* *******: * * ::  :  :* **: :****

2472|gene|nrc1      EVTPMRIKCAVLSEKVVQDGAEIYTGDGDEADRTTTEDDA---
940|gene|nph        DLSPMRIKCAVLAEKVAQDGIAIHQGDAEIDETTTE-------
1226|gene|hut       DISPMRVKCAVLAEKVAQDGAEIYFGEKDLDMTSTEDDDAHEE
13102|gene|hma      DISPMRVKCAVLAEKVAQDGADIFFGEKDIDRTVTEDDD----
353|gene|hhi        DISPMRVKCAVLAEKVAQDGAEIYFGEKDIDRTTTEDDD----
2247|gene|hla       DISPMRVKCAVLGRQVAQDGSKIHRDELDPDDRTKTEE-----
3428|gene|hwa       DISPMRIKCAVLARQVAQDGAAIHDGEIAIEATTVE-------
1150|gene|hbo       DISPMRIKCAVLARQVAQDGAAIYEGDAEKATTTTEADD----
                    :::***:*****. :*.***  *. .: