HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0697COG1828arCOG04462Phosphoribosylformylglycinamidine (FGAM) synthase PurS componentPhosphoribosylformylglycinamidine (FGAM) synthase.PurS component

HOG Organism Gene ID Name Annotation
cHOG0697 nrc1 VNG1944 purS Phosphoribosylformylglycinamidine (FGAM) synthase.PurS component
cHOG0697 hmu HMUK1425 Hmuk_1425 phosphoribosylformylglycinamidine synthase, purS( EC:6.3.5.3 )
cHOG0697 hma RRNAC3269 hypothetical protein
cHOG0697 hwa HQ3130A purS phosphoribosylformylglycinamidine synthase, PurS component
cHOG0697 hla HLAC1250 Hlac_1250 phosphoribosylformylglycinamidine synthase, purS
cHOG0697 hbo HBOR06290 Hbor_06290 phosphoribosylformylglycinamidine synthase, purS protein( EC:6.3.5.3 )
cHOG0697 hut HUTA2231 Huta_2231 phosphoribosylformylglycinamidine synthase, purS
cHOG0697 hvo HVO_2189 HVO_2189 purS phosphoribosylformylglycinamidine synthase purS protein
cHOG0697 nph NP5008A purS phosphoribosylformylglycinamidine synthase, PurS component
cHOG0697 hhi 514 HAH_0514 phosphoribosylformylglycinamidine synthase, PurS component
MUSCLE (3.6) multiple sequence alignment


2231|gene|hut      -------MSTYTATVTVQLKEGVLDPEAETTREALERLGFELDALRAADRFEIDLEATDS
6290|gene|hbo      MTTHYEAMTTYTATVTVRLKQGVLDPEAETTKRALERLGFELESLRSADRFEVEMDAESV
3130|gene|hwa      -------MRMYTATVTVRLKSGVLDPEAETTRRALERLGFEVEALRSADRFEVDIEADSA
13269|hp|hma       -------MTAFTATVTVRLKRGVLDPEAETTQRSLERLGFDLNDLRSADVFELDLDADSA
514|gene|hhi       -------MTAFTATVTVRLKRGVLDPEAETTQRSLERLGFDLNDLRSADVFELDLDADSA
1944|chp|nrc1      -------MTAYTATVTVRLQHGVLDPEAETTQQALERLGFELDALRSADRFEIDLDADDE
1250|gene|hla      -------MTAYTATVTVRLKRGVLDPEAETTQQALERLGFELSDLRSADRFEVDLDAADA
5008|gene|nph      -------MTAYTATVTVRLKRGVLDPEAETTQQALERLGFELEDLRSSDRFEVDLDADDA
                          *  :******.*: **********. :******::. **::* **::::* . 

2231|gene|hut      EAARDRVEEMAERLLANPTIHDYEVAVEQ---------
6290|gene|hbo      AAAEDRADEMAERLLANPTIHDYDVEVTEA--------
3130|gene|hwa      EKAATRADEMAERLLANPTIHDYEVTVEQHTVPSGSQQ
13269|hp|hma       DDAAERAEEMAERLLANPTIHDYDVEVTETE-------
514|gene|hhi       EDAAERAEEMAERLLANPTIHDYDIEVAQAE-------
1944|chp|nrc1      QAAAERADEMAHRLLANPTIHDYDVAVEARE-------
1250|gene|hla      DEAADRADEMAERLLANPTIHDYEVAVAER--------
5008|gene|nph      ESARERATEMAERLLANPTIHDYDVDVAEA--------
                     *  *. *** ***********:: *