HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0695COG1245KOG0063arCOG00187Predicted ATPase RNase L inhibitor (RLI) homologRNase L inhibitor homolog

HOG Organism Gene ID Name Annotation
cHOG0695 nrc1 VNG2612 rli RNase L inhibitor homolog
cHOG0695 hmu HMUK0309 Hmuk_0309 metal-binding domain in RNase L inhibitor, RLI
cHOG0695 hma RRNAC2103 rli putative ATPase RIL
cHOG0695 hwa HQ1372A putative ATPase RIL
cHOG0695 hla HLAC0397 Hlac_397 ABC transporter related
cHOG0695 hbo HBOR27690 Hbor_27690 predicted ATPase, Rnase L inhibitor (RLI) like protein
cHOG0695 hut HUTA0333 Huta_0333 ABC transporter related
cHOG0695 hvo HVO_0424 HVO_0424 rli RNase L inhibitor homolog
cHOG0695 nph NP0678A putative ATPase RIL
cHOG0695 hhi 2592 HAH_2592 putative ATPase RIL
cHOG0695 hhi 100 HAH_0100 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


100|hp|hhi          MADDDV------------------------------------FTETDDPAESWVD-VRMT
678|gene|nph        MSDDSIAVVDLDRCQPDRCNYECVNFCPPNRTGEECIITREERYEDDDHYAGGADQVSIS
333|gene|hut        MADDSIAVVDLDRCQPDRCNYECSNFCPPNRTGKECIVTREDHYDEGEPHEGAPEQVWIS
12103|gene|hma      MAEDSIAVVDLERCQPDRCNYECMNYCPPNRSGKECIVKREDEYEEDEPFEGQPDQVRIS
2592|gene|hhi       MAEDSIAVVDLERCQPDRCNYECMNYCPPNRSGKECIVKREDEYEEDEPFEGQPDQVRIS
2612|gene|nrc1      MADDSIAVVDLDRCQPDRCNYECSNYCPPNRTGKECITLRGE-----DAGDGDPDQVHIS
397|gene|hla        MADDSIAVVDLDRCQPDRCNYECANYCPPNRTGKECITKRGE-----DAAEGDPDQIHIS
1372|gene|hwa       MADDSIAVVDLDRCQPDRCNYECANYCPPNRTGKECIVTRSDYYDDDEPFDGDPNQIRIS
27690|hp|hbo        MADDSIAVVDLDRCQPDRCSYECANYCPPNRTGKECIVTRGEYFEEDEPYDGGPDQIRIS
                    *::*.:                                         :   .  : : ::

100|hp|hhi          D-------------------------PDE---------GE--------------------
678|gene|nph        EELCLGESCGICVEKCPFDAIEIINLPQELDENPTHRYGANSFALYGLPAPQEGRVTGIL
333|gene|hut        EEICLGETCGICVEKCPFDAIQIINLPQELTDDPVHRYGDNAFALYGLPAPGEGRVTGIL
12103|gene|hma      EEICLGESCGICVNKCPFDAIEIINLPQELTDEPVHRYGENAFALYGLPSPAEGQVTGIL
2592|gene|hhi       EEICLGESCGICVNKCPFDAIEIINLPQELTDDPVHRYGENAFALYGLPSPAEGQVTGIL
2612|gene|nrc1      EEICLGESCGICVEKCPFDAIEIINLPQELDDQPTHRYGENSFSLYGLPVPESGKVTGLL
397|gene|hla        EEICLGETCGICVEKCPFDAIEIINLPSELDEEPVHRYGDNAFSLYGLPTPKPGNVTGIL
1372|gene|hwa       EEVCLGESCGICVEKCPFDAIEIINLPVELEDDPVHRYGENAFALYGLPVPDPGTVTGIL
27690|hp|hbo        EEVCLGETCGICVEKCPFDAIEIINLPTELQEEPIHRYGENAFALYGLPVPEPGAVTGIL
                    :                         * *         *                     

100|hp|hhi          ----------------------------------WDV--------------------DVV
678|gene|nph        GPNGIGKTTAVHILADEITPNLGRFDDEPD----WEAVLEAYRGTALQGYLDDLVDGDMT
333|gene|hut        GPNGIGKTTAVHILADELTPNLGDSATSGD----WDAVLEEYRGTALQDYLESLLDGDVT
12103|gene|hma      GPNGIGKTTAVRILADEMQPNLGRYGEEPS----WDEILDEYRGTALQEYLEQMRGGDVD
2592|gene|hhi       GPNGIGKTTAVRILADEMQPNLGRYGEEPS----WDEILDEYRGTALQEYLEQMRDGDVS
2612|gene|nrc1      GPNGIGKSTAVDLLAGEVTPNLGRHESPPD----WDEVVDEYRGTELQDYLAAVRDGDVD
397|gene|hla        GPNGIGKSTAVHALAGEMVPNLGDYESEGD----WERVLDRFRGTGLQNYLQSLKEGDVT
1372|gene|hwa       GPNGIGKTTAVRALAGELVPNLGEYTAEAAETATWDAVLDRYRGTKLQTYIERIRSDDIS
27690|hp|hbo        GPNGIGKTTAVRALAGEMVPNLGTYDEEAT----WEAVLDRYRGTELQNYIERVREEEVS
                                                      *:                     :: 

100|hp|hhi          IAEKQVEYVD--------------------------------------------------
678|gene|nph        VARKPQ-YVDRIPESFDGKTRELLDGVDERGVADELVERLEIEAVIDQPIDTLSGGELQR
333|gene|hut        VARKPQ-YVDEIPDQFDGTTRALLEGTDERGVLDELIERVGIEPVVDQDIDTLSGGELQR
12103|gene|hma      VARKPQ-YVDRIPNQFDGKAIELLDQTDERGALDYLVEQTGIEPVVDNHIDDLSGGELQR
2592|gene|hhi       VARKPQ-YVDRIPDQFDGKAIELLDQTDERGDLDYLIEQTGIEPVVDNHIDDLSGGELQR
2612|gene|nrc1      VAKKPQ-YVDEIPAQFDGNTRQLLEATDERGVLDDLVDRLSIRPVMDQAIDSLSGGELQR
397|gene|hla        VARKPQ-YVDQIPNQFDGNTRELLERTDERGALDSLIDRLNIRPVMDQPIDSISGGELQR
1372|gene|hwa       IAQKPQ-YVDQIPGQFDGTTGELLESTDERGALDSYIDRLDIRPVIDQPLSTLSGGELQR
27690|hp|hbo        IARKPQ-YVDQIPKQFDGITSELLEATDERGKLDEYVERLGIAPVVDQPLDTLSGGELQR
                    :* *   ***                                                  

100|hp|hhi          ------------------------------------------------------------
678|gene|nph        VALAATLVRDADFYFLDEITPYLDIGQRVTAARLIQELSED---DRSMLVVEHDLAVLDL
333|gene|hut        VALVAALARDADFYFLDEVSPYLDIGQRMTAARLIQEMAEE--EDRSMLVVEHDLAILDL
12103|gene|hma      VALVATLARDADFYFLDEITPYLDIGQRMTAARLIRELAEE--EDRSMLVVEHDLAILDL
2592|gene|hhi       VALVATLARDADFYFLDEITPYLDIGQRMTAARLIRELAEE--EDRSMLVVEHDLAILDL
2612|gene|nrc1      VALAATLARDADFYFVDELTPYLDIGQRVTAARLVRELAED--ADKAVLVVEHDLAVLDM
397|gene|hla        VAIAACLARDADFYFLDEITPYLDIGQRMIVARLIRELADDDAAERSMLVVEHDLAILDL
1372|gene|hwa       VALAATLARDRDFYFLDEVSPYLDIAQRVTAARLIRELAED--ANRAVLVVEHDLAILDL
27690|hp|hbo        VALAATLARDRDFYFLDEITPYLDIGQRVTAARLIRELAED--EDKAVLAVEHDLAILDL
                                                                                

100|hp|hhi          ----------------------------------------LRIRPA--------------
678|gene|nph        LADALHVAYGEPGVFGVVTPPKSTKSGINEYLKGYLENENMRIRPEAIEFEEHAPRTESF
333|gene|hut        LADVIHVGYGEPGAFGVITDPKSVKNGINEYLSGYLENENMRIRQDAIEFEEHAPRSVST
12103|gene|hma      LADNINVAYGTPGAFGVITPPKSTKKGINEYLSGYLENENMRIRQTDIEFEEHAPRSASQ
2592|gene|hhi       LADNINVAYGTPGAFGIITPPKSTKKGINEYLSGYLENENMRIRQTDIEFEEHAPRSAST
2612|gene|nrc1      LADSIHVAYGEPSVYGVVTPPKSVRNGINEYLRGYLENENMRVRPEAIEFEEHAPRSASR
397|gene|hla        LADTLHVAYGEPGAYGVVTDPKSVRNGINEYLKGYLDNENMRIRPSAITFEEHAPRVSSR
1372|gene|hwa       LADSLHVAYGEPGAFGVITDPKSVRNGINEYLKGFLSNENMRIRPNKIEFQEHAPRKTAK
27690|hp|hbo        LADTLHIAYGEPGAYGVITDPKSVRNGINEYLKGYLSNENMRIRPDEITFHEHAPRETTK
                                                            :*:*                

100|hp|hhi          -------------------------------------------------LLEG-------
678|gene|nph        GETLVEYPDLTKSYGDGEFTLDVEGGQIQNNEVLGIVGPNGIGKSTFAKLLAGRLD--PD
333|gene|hut        GDVVIEYPGLEKSYGEGEFSLSVEAGQIRESEVLGVVGPNGIGKSTFAKLLADRLE--PD
12103|gene|hma      GDVVIEYPELQKSYGDGEFSLDVEAGTIRESEVLGVVGPNGIGKSTFAKMLAGRLE--PT
2592|gene|hhi       GDVVIEYPELQKSYGSGEFSLDVEAGTIRESEVLGVVGPNGIGKSTFAKMLAGRLE--PT
2612|gene|nrc1      RDTLVSYPDMTKSYGDGEFTLSVEGGDINRNEVLGVVGPNGIGKSTFAQLLAGGLEPSSV
397|gene|hla        SETLIEYPELSKSYGDGEFELHVEGGEINRSEVLGVVGPNGIGKSTLAKLFAGSLE--PD
1372|gene|hwa       STPLIEYPAISKSYGTDEFSLEVESGTIYESEVLGVVGPNGIGKSTLAKLFTGALESDPD
27690|hp|hbo        SEPLVEYPDLSKSYGEGEFSLDVEAGTIYQSEVLGIVGPNGIGKSTLAKMFAGGLE--PD
                                                                     :: .       

100|hp|hhi          -------------------------------FLDCLFDDLSD------------------
678|gene|nph        SGS----FDADLDISYKPQYVEIDQPMRVDAFLRSITDDFGSSYWNTEIAQPLQLDRIME
333|gene|hut        AGE----LDASVDISYKPQYVEVDQPMRVDAFLGSIAEDFGTSYWNTEIAQPLQLDRIME
12103|gene|hma      AGE----IDTSLDIAYKPQYIEIDQPMRVDAFLASITDDFGSSYWNTEIAQPLQLESVME
2592|gene|hhi       AGE----IDTSLDIAYKPQYIEIDQPMRVDAFLASITDDFGSSYWNTEIAQPLQLESVME
2612|gene|nrc1      GGEAGAALDVGLDIAYKPQYVEADQQMRVDAFLSSVTDDVGTSYWQTEIADPLQLDPIME
397|gene|hla        EGE----LDFALDIAYKPQYIDIDQPMRVDVFLSSITDDFGSSYWNTEIAQPLQLDRVME
1372|gene|hwa       SQS----LSFQLDIAYKPQYIEIDQPMRVDAFLSSITNDFGTSYWKTEISQPLQLEQIME
27690|hp|hbo        EGE----LDFRLDIAYKPQYIEIDQPMRVDAFLSSITDDFGTSYWKTEVANPLQLNRIME
                                                   ** .: :*..                   

100|hp|hhi          ---------ERAQSLLAATLERQ-------------DVD---------------------
678|gene|nph        QDLTDLSGGERQRVAIAACLSKEADIYLLDEPSAHLDVEQRVLATRAIRRYTETHDKTAM
333|gene|hut        QQLTDLSGGERQRVAIAACLSRDADLYLLDEPSAHLDVEQRVLATSAIRRYAENHDATAM
12103|gene|hma      QQLTDLSGGERQRVAIAACLSKDADLYLLDEPSAHLDVEQRVMATSAIRRYAENHDATAM
2592|gene|hhi       QQLTDLSGGERQRVAIAACLSKDADLYLLDEPSAHLDVEQRVMATSAIRRYAENHDATAM
2612|gene|nrc1      QRLPDLSGGERQRVAIAATLSKDADLYLLDEPSAHLDVEQRVLATRAIRRFAENNESTVM
397|gene|hla        QNLSDLSGGERQRVAIAACLSEDADLYLLDEPSAHLDVEQRVRATTAIRRYAENHDATVM
1372|gene|hwa       RNLDDLSGGERQRVAIAACLSDDADLYVMDEPSAHLDVEQRVQATSAIRRYAENNDETVL
27690|hp|hbo        RNLDDLSGGERQRVAIAATLSEDADLYVMDEPSAHLDVEQRVQATTAIRRYAENHDATVM
                             ** .  :** *. :             **:                     

100|hp|hhi          ----------------------PSDLA---------------------------------
678|gene|nph        VIDHDIYMIDLLADRLQVFEGTPAEHGRAGSPVGMREGMNTFLSNLDVTFRRDERTGRPR
333|gene|hut        VIDHDIYMIDLLADRLLVFDGEPAVAGHASTPQSMRSGMNDFLGNLDITFRRDERTGRPR
12103|gene|hma      VIDHDIYMIDLLADRLLVFDGEPAKNGHAAPPQGMREGMNEFLQNLDITFRRDERTSRPR
2592|gene|hhi       VIDHDIYMIDLLADRLLVFDGEPARNGHAAPPQGMREGMNEFLQNLDITFRRDERTSRPR
2612|gene|nrc1      VIDHDIYMIDLVSDRLMVFDGEPAEHGQASPPQAMRSGMNEFLANLDVTFRRDERLGRPR
397|gene|hla        VIDHDIYMIDLLADRLMVFDGEPAERGHATPPQEMRDGMNEFLADLDITFRRDERTGRPR
1372|gene|hwa       VIDHDIYMIDLLADRLMVFDGQPSEYGHASAPQEMRAGMNDFLSDLDITFRRDERTQRPR
27690|hp|hbo        VIDHDIYMIDLLADRLMVFDGEPSVEGHARTPQEMRAGMNDFLSDLDITFRRDERTQRPR
                                          *:  .                                 

100|hp|hhi          ---------------GE---------
678|gene|nph        INKPGSQKDREQKKQGEYYYAPAENQ
333|gene|hut        INKPESRLDREQKQAGEYYYAPE---
12103|gene|hma      INKPDSQLDREQKNAGEYYYAP----
2592|gene|hhi       INKPDSQLDREQKNAGEYYYAP----
2612|gene|nrc1      INKPDSQLDKQQKRDGEYYYTT----
397|gene|hla        INKPGSQLDSSQKRDGEYYYSG----
1372|gene|hwa       INKPGSQLDRRQKQQGEYYYAP----
27690|hp|hbo        INKPGSQLDSQQKREGEYYYSTSN--
                                   **