HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0694COG1867KOG1253arCOG01219N2N2-dimethylguanosine tRNA methyltransferaseN2.N2-dimethylguanosine tRNA methyltransferase

HOG Organism Gene ID Name Annotation
cHOG0694 nrc1 VNG2088 trm1 N2.N2-dimethylguanosine tRNA methyltransferase
cHOG0694 hmu HMUK0713 Hmuk_0713 N2,N2-dimethylguanosine tRNA methyltransferase( EC:2.1.1.32 )
cHOG0694 hma RRNAC2788 trm1 N(2),N(2)-dimethylguanosine tRNA methyltransferase
cHOG0694 hwa HQ3646A trm1 N(2),N(2)-dimethylguanosine tRNA methyltransferase
cHOG0694 hla HLAC2358 Hlac_2358 N2,N2-dimethylguanosine tRNA methyltransferase
cHOG0694 hbo HBOR29540 Hbor_29540 N(2),N(2)-dimethylguanosine tRNA methyltransferase( EC:2.1.1.32 )
cHOG0694 hut HUTA1529 Huta_1529 N2,N2-dimethylguanosine tRNA methyltransferase
cHOG0694 hvo HVO_0236 HVO_0236 N2 N2-dimethylguanosine tRNA methyltransferase
cHOG0694 nph NP0194A trm1 N(2),N(2)-dimethylguanosine tRNA methyltransferase
cHOG0694 hhi 70 trm1 N(2),N(2)-dimethylguanosine tRNA methyltransferase
MUSCLE (3.6) multiple sequence alignment


2088|gene|nrc1      MDVSEGGVTVSVPTA-SGGGEGAADDVFFNATQELNRDLTVATLAAFREREPR-----AA
2358|gene|hla       MDIEEGGLTVSVPEARDGASEGTGGGVFFNPTQELNRDVTVAVLRAYRDREPR-----AS
3646|gene|hwa       MNITEGVVELTVPAARDGADAGVGDDVFYNPTQELNRDITVAALRAYQEREPR-----AE
29540|gene|hbo      MDVREGGIEVEVPGARDGASEGAGDDVFYNPTQELNRDVTVATLRAYRERDDR-----AE
194|gene|nph        MEVSEGSVTVEVPEERHGASEGSGEGVFYNPVQELNRDITAAVLRTVSDD--------CD
1529|gene|hut       MREREGRVTVTVPEQ---AEEGVGESVFFNPVQELNRDLTVAAIRAVRERVAERDGHPVE
12788|gene|hma      MRVSEGRVTVTVPEQ---PEAGKGADVFFNPVQELNRDITVAALRAYRERTPR-----VS
70|gene|hhi         MRVSEGRVTVTVPEQ---PEAGKGADVFFNPVQELNRDITVAALRAYRERTPR-----VS
                    *   ** : : **        * . .**:*..******:*.*.: :  :           

2088|gene|nrc1      SYLDAMTASGIRGVRAANAGWDVTMADVDADAVELATSNLARNGLDGEVVARDANSLLHD
2358|gene|hla       SYLDAMAASGIRGVRAAAEGYDTTCADVDPDAVELAAENLAANDLDGETVHRDVNALLY-
3646|gene|hwa       TYLDAMTASGVRGVRAAASGYDVTCTDIDPDAVALAQSNLEKNDLDGQTLPSDANAVLHQ
29540|gene|hbo      SYLDAMAASGIRGVRAAAEGFDVTCADLDESAVELARRNLERNELDGEAVHRNANALMY-
194|gene|nph        EYLDAMAASGIRSVRAAAAGYDVTACDIDDDAVALTRRNLDRNGVDGTVHHRNVNAHMH-
1529|gene|hut       TYLDATAATGVRGVRAAENGFDATLCDVDEAAVERCRENLAGNDLDGEVLHRDANAVMH-
12788|gene|hma      TYLDATAASGIRGVRAAANDWETTLCDIDDDATALCEQNLERNDLAASVRRSDANVLMH-
70|gene|hhi         TYLDATAASGIRGVRAAANDWETTLCDIDDDATALCEQNLERNDLAASVRRSDANVLMH-
                     **** :*:*:*.****  .::.*  *:*  *.     **  * : . .   :.*  :: 

2088|gene|nrc1      H--------DRVLDVVDIDPFGSPMPFADAAFANARNLVCVTATDTAPLCGAHFESGVRK
2358|gene|hla       ---------ENVFDVVDLDPYGTPIPFADAALANARNLVCVTATDTAPLCGAHLNSGIRK
3646|gene|hwa       SGPESPLGPEAIFDVVDLDPFGTPIPFADAAFANARNLVCVTATDTAPLCGAHQQSGIRT
29540|gene|hbo      ---------DSVFDIVDLDPFGTPIPFADAAFANTRDLVCVTATDTAPLCGAHQKSGIRK
194|gene|nph        ---------ESAHDVVDLDPFGTPMAFADAAVRSAGEYLCVTATDTAPLCGAHFESGVRS
1529|gene|hut       ---------ERQFDIVDLDPFGTPIPFVDAALQSAGRMLAVTATDLAPLCGAHFESGVRS
12788|gene|hma      ---------SEAFDVVDVDPFGTPIPFADAAVQGTKHLLCVTATDTAPLCGAHFESGVRS
70|gene|hhi         ---------SEAFDVVDVDPFGTPIPFADAAVQGTKHLLCVTATDTAPLCGAHFESGVRS
                             .   *:**:**:*:*:.*.***. .:   :.***** ******* :**:*.

2088|gene|nrc1      YSATPRNTNYHAEMGLRILLGALARTAARYDVGVTPILSHVSDHYVRTYLELDHRATDAN
2358|gene|hla       YGAVPRNTDYHPEMGLRTLISALVRTAARYDKAARPIVSHVSRHYARTYLELESGAQVAD
3646|gene|hwa       YSTLPRNTEYHPEMGLRVLLSALIRTAARYDTAAIPILSHVTRHYVRTYLELDTRATRAD
29540|gene|hbo      YSTLPQNTDYHPEMGLRVLLSAMIRTAARYDKAAVPILSHVTRHYARTYLELDGRATKAD
194|gene|nph        YDAVPRNTEFHAEMGLRVLLSALVRTAARHDIAAEPVLSHVTSHYVRTYLRVDSGARAAD
1529|gene|hut       YSAVPRNTEYHSEMGARILLGSLVRTAARYDIAARPALTHATDHYVRTYLDLERGARAAD
12788|gene|hma      YGAVPRNTEFHAEMGMRVLLSAMVRTAARYDIAARPILSHATKHYARTYLEFDHGAKVAN
70|gene|hhi         YGAVPRNTEFHAEMGMRVLLSAMVRTAARYDIAARPILSHATKHYARTYLEFDHGAKVAN
                    *.: *.**::*.*** * *:.:: *****:* .. * ::*.: **.**** .:  *  *:

2088|gene|nrc1      AAVEQVGHVYHCQQCLSRDHEYGLVAAPRAECPRCGGHQVLTAGPLWLGPAHEEAFAASV
2358|gene|hla       DCIDELGYIDNCEDCLWRDPTHGLIADPVDTCPVCGSDRVLTAGPLWLGPVADPDFARAV
3646|gene|hwa       ELLSDLGYVYHCEDCLTRQHEFGHIAHPPSMCHHCEGNRVITAGPLYLGSIREQGFTRRV
29540|gene|hbo      ELVEQLGYVYHCEDCLERDHEFGLIAHPPDDCPACGSSRTLVAGPLYLGPVCDPDFTRRV
194|gene|nph        ALLEHLGYIDHCQRCLWRDHERGRVPDPTTTCPHCGQS-TWTAGPVWLGPAHDAAFVDDV
1529|gene|hut       DAIGELGYVHHCQQCLYREAENGLIAHPPEACPKCGQH-LQTAGPLWLGAAHKTDFLERV
12788|gene|hma      DCIDELGYVHHCQHCLWRDHDYGLIADPPEDCPVCEKH-LQTAGPIWLGRTCDPEFVSAV
70|gene|hhi         DCIDELGYVHHCQHCLWRDHDYGLIADPPEDCPVCDKH-LQTAGPIWLGRTCEPAFADAV
                      :  :*:: :*: ** *:   * :. *   *  *      .***::**   .  *   *

2088|gene|nrc1      REQLTREMGEASQAFHLLQTIEGELHEPTHYDQHRLYSQWGEPAVGMAEFLDQLRDAGLR
2358|gene|hla       RERVTDDMGEAKRARKLLGTVARELDTPTHYDQHRLYKAWGEPAIGMDEFVDRLRGAGYE
3646|gene|hwa       RNHITTEMGEIKQADSILKMVENELETPTHYDQHRLCKKWTRSAIGMDEFIEQLHTAGFD
29540|gene|hbo      RDHITEEMGEKKRARSMLETVAGELDRPTHYDQHRLCKMWSRSATSMDDFLAELRDAGYE
194|gene|nph        AGAIPDSFGTADKARDLLSTVATELHQPTHYDQHKLYKRWNEPNIAMDDFLAALRAAGHE
1529|gene|hut       RGQIDDGMGTAEEGRELLETLADELDVATHYDQHRLTKRWGESAVAMADFLDALREAGHE
12788|gene|hma      SEQVSEEMGTADEAKELLATLGAEIDTPTHYDQHRLCKRWGRGAEAMDEFIEKLRDAGYA
70|gene|hhi         SEQVTEEMGTADEARELLATLSEEIDTPTHYDQHRLCKRWGRGAEAMDEFIEKLRDTGYE
                       :   :*  . .  :*  :  *:  .******.* . *     .* :*:  *. :*  

2088|gene|nrc1      ASRTHFGGTTFKTDGGLAEVEAAVL-----------
2358|gene|hla       ASRAHYRGTAVKSTASIPEMRDAILGNEGDADGDAD
3646|gene|hwa       ATRTHYSGTAFKTNATIAEIRSATTDPDEQ------
29540|gene|hbo      ATQAHYSGTAFKTNATIEEMRAVTTDSDN-------
194|gene|nph        ASRTHYGGTTFKTDADVADIRNAVE-----------
1529|gene|hut       ASRTHYGGTTFKTTADVSEIRAATAGDE--------
12788|gene|hma      ASRTHYGGTTFKTDADVVEIREATAD----------
70|gene|hhi         ASRTHYGGTTFKTDADVVEIREATAE----------
                    *:.:*: **:.*: . : ::  .