HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0693COG0127KOG3222arCOG04184Xanthosine triphosphate pyrophosphataseHAM1 protein homolog

HOG Organism Gene ID Name Annotation
cHOG0693 nrc1 VNG2043 ham1 HAM1 protein homolog
cHOG0693 hmu HMUK1176 Hmuk_1176 Ham1 family protein( EC:3.6.1.15 )
cHOG0693 hma RRNAC2493 ham1 Ham1 protein
cHOG0693 hwa HQ1343A ham1 nucleoside-triphosphatase
cHOG0693 hla HLAC2200 Hlac_2200 Ham1 family protein
cHOG0693 hbo HBOR04980 Hbor_04980 dITPase( EC:3.6.1.15 )
cHOG0693 hut HUTA1510 Huta_1510 non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
cHOG0693 hvo HVO_1893 HVO_1893 Ham1 family
cHOG0693 nph NP4426A ham1 nucleoside-triphosphatase
cHOG0693 hhi 2924 ham1 Ham1 protein
MUSCLE (3.6) multiple sequence alignment


1510|gene|hut       ----------------------------MLRFVTGNDGKLREARAALDD--DVTQFSFDY
1343|gene|hwa       MEVHANSIPSEITAVTNQHTVALFVSADILRYVTTNSGKVREARQYLDP-DAIKSLSYDY
4426|gene|nph       ----------------------------MLRYVTTNDGKVREAEAYLDD--DVAAFEYDY
2043|gene|nrc1      --------------------------MSTLRFVTTNSGKVQEAASYLDGLRRVEQLDYDY
2200|gene|hla       ----------------------------MLRYVTTNPGKVREAERYLPD-GSVERLDFDY
4980|gene|hbo       ----------------------------MLHYVTTNAGKVREALQYLAD---VEQLDYDY
12493|gene|hma      ----------------------------MLNFVTTNPGKVREATEYLDD--DVQQFDFDY
2924|gene|hhi       ----------------------------MLNFVTTNPGKVREATEYLDD--EVEQFDFDY
                                                 *.:** * **:.**   *     :  :.:**

1510|gene|hut       TEIQSHDLGAIAAHGAREAYREVGE--AVMVEDSGLFVDALDGFPGPYSAYVEDTLGIER
1343|gene|hwa       TEIQATSLRPIAATGAHEAYHYTDS--PVLVDDAGLFIDDFDGFPGPYSAFVENTLGVKT
4426|gene|nph       QEIQADSLEAVAADGARKAYRHVGE--PVIVDDAGLYLEGFDGFPGPYSAYVENTLGVEC
2043|gene|nrc1      AELQSDDLAAIATHGAREAYRETDDDTPVIVDDAGLFVRGLSGFPGPYSAYVEDTLGIER
2200|gene|hla       PEIQAAELGPIAAQGAREAYRHAGE--PVLVDDAGMFVEGLDGFPGPYSSYVEETLGIER
4980|gene|hbo       TEVQASDLGPIAAHGAREAYRHAGE--PVLVDDAGLFIDGFEGFPGPYSSFVEDTLGVET
12493|gene|hma      PEVQADDLRTVAAKGARAAYRAADG--PVIVDDAGLFIDAFDGFPGPYSSYVEDTVGVER
2924|gene|hhi       PEVQADDLKTVAAEGARAAYRAADG--PVIVDDAGLFIDAFDGFPGPYSSYVEDTVGVER
                     *:*: .* .:*: **. **. ..   .*:*:*:*:::  :.*******::**:*:*:: 

1510|gene|hut       IWRLTEP--EADHAAAFRSLIAYCDGSAFGSAPT---IRDGD------------------
1343|gene|hwa       VQRVVESESEISRDATFRCVLAYCDGEAIEPSDDEYLNTNTD------------------
4426|gene|nph       VGRLARR--EEATQAKFRCVIAYCDGDSFEASPEP--VDTDDRRGTDIDADERATAATDE
2043|gene|nrc1      VWELASD--LDDRHAAFRCVVAYTDGDTVET-----------------------------
2200|gene|hla       VHDIAAD--LADRRAAFRCVLGYCDGDGFAASPDP--VDRGDRDAAAAAGPDGEGGRDGE
4980|gene|hbo       VYRLAESELEEPRRASFDCVLAYCDGEGFEATPDP--VDRDDR----TVAAARGAEQDDE
12493|gene|hma      VWRMTEP--EDDRGAAFKTVIAYCDGEGFEATPDPGGIDREDRRGQDLSADDRGTATTDE
2924|gene|hhi       VWRMTEP--EDDRGAAFKTVIAYCDGEGFEATPDPGGIDREDRRGQDLAADDRGAATTDE
                    :  :.         * *  ::.* **. . .                             

1510|gene|hut       -------------PPVAIFEGRVDGQIVAPRGEGGFGYDPIFEYDDRTFAERDPDEKNEY
1343|gene|hwa       ----------TETPPVKLFTGEVSGRIVPPRGNGGFGYDPIFEYDGMTLAERDAAEKNEI
4426|gene|nph       TVAG-------EELPVKLFPAAVPGHIVEPRGDGGFGYDPIFEHDGTTFAEMTPEEKNAV
2043|gene|nrc1      ------------------FTGAVQGTMVAPRGDGGFGYDPIFEHDGTTFAEMPTDRKNAL
2200|gene|hla       D--GGVERGDVETLPVKLFEGYVPGRIVAPRGEGGFGYDPIFEHDGETFAEMDTDRKNAV
4980|gene|hbo       E---------TEALPVKLFRGTVRGRIVPPRGEGGFGYDPIFEHEGTTFAEMSSEEKNAI
12493|gene|hma      QVHDGSAAQSSETVPVKLFEGRVNGEIVAPRGEGGFGFDPIFEHDGTTFAEMSTEQKNAI
2924|gene|hhi       QVHDGSAGRSSETVPVKLFEGRVNGEIVAPRGEGGFGFDPIFEHDGTTFAEMSTEQKNAI
                                      * . * * :* ***:****:*****::. *:**  .  **  

1510|gene|hut       SHRGRALDAFAEWYDGEGDADS
1343|gene|hwa       SHRGRALTAFAEWFQAR-----
4426|gene|nph       SHRGRALSTFAEWYAGR-----
2043|gene|nrc1      SHRGRALATFADWLAERAD---
2200|gene|hla       SHRGRALEKFAEWYADR-----
4980|gene|hbo       SHRGRALAKFGEWFAERTE---
12493|gene|hma      SHRGRALAKFAEWYGER-----
2924|gene|hhi       SHRGRALSKFAEWYGER-----
                    *******  *.:*