HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0692COG1358KOG3406 KOG3166 KOG3167 KOG3387arCOG01751Ribosomal protein HS6-type (S12/L30/L7a)30S ribosomal protein HS6

HOG Organism Gene ID Name Annotation
cHOG0692 nrc1 VNG1157 rphs6 30S ribosomal protein HS6
cHOG0692 hmu HMUK2621 Hmuk_2621 ribosomal protein L7Ae/L30e/S12e/Gadd45
cHOG0692 hma RRNAC0103 rpl7ae 50S ribosomal protein L7Ae
cHOG0692 hwa HQ2885A rpl7ae 50S ribosomal protein L7Ae
cHOG0692 hla HLAC1842 Hlac_1842 ribosomal protein L7Ae/L30e/S12e/Gadd45
cHOG0692 hbo HBOR12060 Hbor_12060 LSU ribosomal protein L7AE
cHOG0692 hut HUTA0750 Huta_0750 ribosomal protein L7Ae/L30e/S12e/Gadd45
cHOG0692 hvo HVO_2737 HVO_2737 RPL8A 50S ribosomal protein L7Ae
cHOG0692 nph NP3660A rpl7ae 50S ribosomal protein L7Ae
cHOG0692 hhi 858 rpl7ae 50S ribosomal protein L7Ae
MUSCLE (3.6) multiple sequence alignment


10103|gene|hma      ---MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQP
858|gene|hhi        ---MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQP
750|gene|hut        ---MPVYVDFDVPADLEDDALEALEVARDTGRVKKGTNETTKAIERGNAELVVVAEDVQP
2885|gene|hwa       ---MPVYVEFDVPADLADDALEALEVARDTGTVKKGTNETTKAIERGTAELVLVAEDVSP
3660|gene|nph       ---MSVYVDFDVPADLEDDALEALEVARDTGSVKKGTNETTKAVERGNAELVFVAEDVSP
12060|gene|hbo      MNNMAVYVEFDVPADLAEDALEALEVARDTGTVKKGTNETTKAVERGNAELVLVAEDVSP
1157|gene|nrc1      ---MPVYVDYDVPADLQERALESLEVARDTGSVKKGTNETTKAIERGNADIVFVAEDVSP
1842|gene|hla       ---MPVYVDYETPADLAERSLEALEVARDTGTVKKGTNETTKAVERGNADLVIVAEDVSP
                       *.***:::.**** : :**:******** **********::***.*::*.*****.*

10103|gene|hma      EEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVE
858|gene|hhi        EEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVE
750|gene|hut        EEIVMHIPELAAEKDVPYLFVGAQDDLGHAAGLEVGSAAAAIVDAGDADGDVEDIAGKVE
2885|gene|hwa       EEIVMHLPELADEKGITLAFVETQDEIGQAAGLEVGSAAAAIIDAGEADSDVDDITAKIE
3660|gene|nph       EEVVMHLPEIATEKEIPYVFVGTQDDIGHAAGLQVGSAAAAIVDAGEANGEVEDIAEKVE
12060|gene|hbo      EEIVMHLPEIADEKGIPYIFIETQDEVGHAAGLEVGSAAAAIVDAGEAQEQVEDIAAKVE
1157|gene|nrc1      EEIVMHLPELAAEKGIEVVFVETQDELGNAAGLEVGSAAAAVVAAGDAEDEIEDISTKVE
1842|gene|hla       EEIVMHLPELAEEKGIPVVFVDTQDEVGHAAGLEVGSAAAAVIDAGDADDDVEDIGEKVA
                    **:***:**:* ** :   *:  **::*:****:*******:  **:*: :::**  *: 

10103|gene|hma      ELR
858|gene|hhi        ELR
750|gene|hut        DLR
2885|gene|hwa       ELR
3660|gene|nph       ELQ
12060|gene|hbo      ELQ
1157|gene|nrc1      DLQ
1842|gene|hla       ELR
                    :*.