HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0691COG1889KOG1596arCOG00078Fibrillarin-like rRNA methylasefibrillarin

HOG Organism Gene ID Name Annotation
cHOG0691 nrc1 VNG1176 fib fibrillarin
cHOG0691 hmu HMUK2238 Hmuk_2238 fibrillarin
cHOG0691 hma RRNAC0865 fib fibrillarin
cHOG0691 hwa HQ2567A flpA fibrillarin
cHOG0691 hla HLAC1042 Hlac_1042 fibrillarin
cHOG0691 hbo HBOR15440 Hbor_15440 rRNA 2'-O-methyltransferase fibrillarin
cHOG0691 hut HUTA0406 Huta_0406 fibrillarin
cHOG0691 hvo HVO_1669 HVO_1669 fib fibrillarin-like pre-rRNA processing protein
cHOG0691 nph NP2062A flpA fibrillarin
cHOG0691 hhi 1503 nop1 fibrillarin
MUSCLE (3.6) multiple sequence alignment


2567|gene|hwa       MKASSS---------LPDGVQRRQFDNRSR-LTTHGTTVYGEPRDTDGWRLWDAGRSKLG
406|gene|hut        ----MS---------LPDGVTRRAFDGTQS-LATTGEPVYGEST-SEGWRQWVPDRSKLG
1176|gene|nrc1      ----MS---------LPAGVQRRSFGDEDGVLATRGEPAYGEPV-VDGWRRWDAHRSKLG
2062|gene|nph       ----MS---------LPKGVQRRDFGDGER-LATEGPPVYGEPT-ADGWRQWDPRRSKLG
10865|gene|hma      ----MT---------LPSGVERHDFGGETS-LATQGQPVYGERTDGD-WRRWDPHRSKLG
1503|gene|hhi       ----MT---------LPTGVERHDFDGETS-LATQGQPVYGERTDGD-WRRWDPHRSKLG
1042|gene|hla       ----MSE------PNLPAGVERREIGGETR-LATRGPPVYGEPT-ADGWRAWDPGRSKLG
15440|gene|hbo      ----MTD--------LPSGVERRPFDGRER-LSTHGETVYGEPRDEDGWRAWDAGRSKLG
1669|gene|hvo       ----MSDDGSAADAALPDGVERRTFGGRER-LSTRGEPVYGEPVDSDGWRAWDAGRSKLG
                         :         ** ** *. :..    *:* * ..***    : ** * . *****

2567|gene|hwa       AMFKLDIETGLTGGESILYLGAASGTTVSHVADFAGPTYAIEFAPRPVRDLLEVATTRPN
406|gene|hut        AMFELGVDTGLAGGETVLYLGAASGTTVSHVADFAGPTYAVEFAPRPMRDLLEVAADRDR
1176|gene|nrc1      ATFELGLDTGLSGGDAVLYLGAANGTTVSHVADFAGPTYAVEFAPRPVTDLLAVADSRER
2062|gene|nph       AMLETDIDTGLVGGETVLYLGAAAGTTVSHVADFAGPTYAVEFAARPARDLLTAAEPRPN
10865|gene|hma      AMLAHGMDTGLGGGETVLYLGAAAGTTVSHVADFGGPTYAVEFAPRPVRELLDAAESRRN
1503|gene|hhi       AMLEQGMDTGLEGGETVLYLGAAAGTTVSHVADFGGPTYAVEFAPRPVRELLDAAESRRN
1042|gene|hla       GMFELGFETGLSGGETVLYLGAASGTTVSHVADFAGPTYAVEFAPRPARDLVEAAEPRDR
15440|gene|hbo      AMFEYGMDTGLVGDETVLYLGAASGTTVSHVADFAGPTYAVEFAARPVRDLLGVAEARDN
1669|gene|hvo       AMLELGMDTGLVGGESVLYLGAASGTTVSHVADFAGPTYAVEFAPRPVRDLVGVAEDRDN
                    . :  ..:*** *.:::****** **********.*****:***.**  :*: .*  * .

2567|gene|hwa       LIPLLCDARQPETYAHVVETDIEYLIQDVATRGQATVALRNRQFLAPDGKLILMIKARSE
406|gene|hut        LFPLLKDARAPETYAHVVEP-VDAIIQDVATRGQADVALSNRRFLRDDGRLVMAIKARSE
1176|gene|nrc1      LFPLLKDARAPETYAHVVESGVDAIVQDVATRGQADVALSNRQFLADDGRLVAALKARSE
2062|gene|nph       LIPLLKDARKPDTYTHVVEP-VDVLIQDVATRGQAKVALANRRFLRDDGRLLLAIKARSE
10865|gene|hma      LFPLLKDARKPESYAHVVEP-VDVVVQDVATRGQARVATLNKQFLTDDGRLLAAIKARSE
1503|gene|hhi       LFPLLKDARKPENYAHVVEP-VDVVVQDVATRGQARVATLNKQFLTDDGRLLAAIKARSE
1042|gene|hla       LFPLLKDARTPKRYAHVVESDVDAIVQDVATRGQAEVAVRNARFLADDGRLLLAIKARSE
15440|gene|hbo      LFPLLKDARKPETYAHIVEADLDCIVQDVATRGQATVANRNRQFLRDDGRLLAVIKARSE
1669|gene|hvo       LFPLLKDARDPDSYAHVVEAGIDCLVMDVATRGQATVAVRNRQFLADDGRLLMAVKARSE
                    *:*** *** *. *:*:**. :: :: ******** **  * .**  **.*:  :*****

2567|gene|hwa       DVLSDPEDVFDTIISTLREGYIIQTRQRLDRFHDDHLAVVATPNM-
406|gene|hut        DVTREPDAVFADVIDRLKTGYEILDRQSLEPYHDDHLAVIARPR--
1176|gene|nrc1      DVTADPAAVFEDLLGRLRDGYEVRATARMEPFHEDHLAVVATPR--
2062|gene|nph       DVTADPDAVFDDVLEELTTGYDIVETRSLERFHEDHLAVVAEPSGD
10865|gene|hma      DVTADPDAVFDSVRAELSAEYELLETARLDPYHEDHLGIVARPRKD
1503|gene|hhi       DVTADPDAVFDSVRTELSAEYELLETARLDPFHEDHLGIVARPRED
1042|gene|hla       DVTVEPETVFEGALDRLRETYEILETQRLDRFHEDHLGVVATPK--
15440|gene|hbo      DVTADPDDVFEDVLTELREAYEILETTRLDRFHDDHLGVVARPK--
1669|gene|hvo       DVTAEPDDVFDDVIAELDSAYELLETARLDRFHADHLGIVARPK--
                    **  :*  **      *   * :     :: :* ***.::* *