HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0690COG2097KOG0893arCOG04473Ribosomal protein L31E50S ribosomal protein L31E

HOG Organism Gene ID Name Annotation
cHOG0690 nrc1 VNG2467 rpl31e 50S ribosomal protein L31E
cHOG0690 hmu HMUK1233 Hmuk_1233 Ribosomal protein L31e
cHOG0690 hma RRNAC3113 rpl31E 50S ribosomal protein L31e
cHOG0690 hwa HQ3423A rpl31R 50S ribosomal protein L31e
cHOG0690 hla HLAC0827 Hlac_827 Ribosomal protein L31e
cHOG0690 hbo HBOR01070 Hbor_01070 LSU ribosomal protein L31E
cHOG0690 hut HUTA0999 Huta_0999 Ribosomal protein L31e
cHOG0690 hvo HVO_0116 HVO_0116 Ribosomal protein L31e
cHOG0690 nph NP1014A rpl31R 50S ribosomal protein L31e
cHOG0690 hhi 380 rpl31E 50S ribosomal protein L31e
MUSCLE (3.6) multiple sequence alignment


2467|gene|nrc1      MSASEFDDRFVTVPLRDVTKVPSHERAGEAMNIIRQHLAKQFAVDEDAVRLDPSINDAVW
827|gene|hla        MSTSDFEERVVTVPLRDANDKPIQERADFAMKIVREHLAQHFSVDEAEVVLDTTVNEAVW
1014|gene|nph       -MSAEFDERVMTVPLRDVLAESKGQRADKAMSLVRSHLAQHFNVEEDAVRLDPSINEAVW
13113|gene|hma      MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAW
380|gene|hhi        MSASDFEERVVTVPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAW
999|gene|hut        MSAEEFEERVVTVPLRDVQAVPSGDRAGRAMSLVREHLAQHFSVAGDDVRLDPSINEEIW
1070|gene|hbo       MSASDFEERVITVPLRDVKAVPSYERAGRAMKIIREHLAQHFSVDPEDVRLEPEINEQIG
3423|gene|hwa       MSTSDFEERVVTVPLRDVSAVPTHERAGRAMTLIREHLAQHFRVDESDIRLDPSLNETVW
                      : :*::*.:*:****.   .  .**. ** ::*.***::* *    : *:. :*:   

2467|gene|nrc1      SEGNNNPPRKLRVHAGSFAEDGETVVEADYEG
827|gene|hla        ANGRQNPPSKVRVRAARFVEDGEPVVEAEYAE
1014|gene|nph       ERGRSKPPSELRVRAARFEEEGEAVVEAETA-
13113|gene|hma      ARGRANTPSKIRVRAARFEEEGEAIVEAETAE
380|gene|hhi        ARGRANTPSKIRVRAARFEEEGEAIVEAETAE
999|gene|hut        ADGRSNPPSSIRVRAARFEEAGESVVEAEPAE
1070|gene|hbo       GRGRQTPPSKFRVRAARFDEDGEQIVEAEPAE
3423|gene|hwa       ARGSQNPPSKLRVRAARFDEDGESIVEAEPAE
                      *  ..* ..**.*. * * ** :***: