HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0069COG3380arCOG04623Predicted NAD/FAD-dependent oxidoreductasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0069 nrc1 VNG0622 vng622 no entry
cHOG0069 hmu HMUK2190 Hmuk_2190 FAD dependent oxidoreductase
cHOG0069 hmu HMUK2015 Hmuk_2015 conserved hypothetical protein
cHOG0069 hma RRNAC0970 aor3 flavin-containing amine-oxidoreductase
cHOG0069 hwa HQ3119A NAD/FAD-dependent oxidoreductase
cHOG0069 hla HLAC1925 Hlac_1925 hypothetical protein
cHOG0069 hbo HBOR06680 Hbor_06680 predicted NAD/FAD-dependent oxidoreductase
cHOG0069 hut HUTA2785 Huta_2785 FAD dependent oxidoreductase
cHOG0069 hut HUTA0167 Huta_0167 FAD dependent oxidoreductase
cHOG0069 hvo HVO_2229 HVO_2229 flavin-containing amine-oxidoreductase
cHOG0069 nph NP3824A hypothetical protein
cHOG0069 hhi 1599 HAH_1599 flavin-containing amine-oxidoreductase
MUSCLE (3.6) multiple sequence alignment


2785|gene|hut       --------------------MREEIGIVGGGIAGAGAAYALADA----DVTVYE-MDTVG
167|gene|hut        --------------------MTSKVCIVGAGIAGAGAAYALDEA---AEVTVFE-AEDIG
10970|gene|hma      --------------------MARNLAVVGAGGAGAAAAYALRDA--DVNVTVFEKSRGVC
1599|gene|hhi       --------------------MARNLAVVGAGGAGAAATYALHDA--EVDVTVFEKSRGVC
1925|hp|hla         -------------------MTVTHIGIVGAGAGAAAAAFTVDGAVPDADVTVFEKSGGLC
3824|hp|nph         ---------------------MVHIGIVGAGAAAAAATFVIDQTLPDAEVTVLEKSGGVC
622|hp|nrc1         ---------------------MDSLAIVGAGPAGAAAAYGLREA--DREITVFEKSRGVC
3119|gene|hwa       MSQSSQNSAKLTETTSDEMESSFDVGIIGAGPAGAGAAYALCDS--DATVTVLEKSGGVC
6680|hp|hbo         --------------------MTLRVGIVGAGAAGVGAAYALRNA--DAEVTIVEKSRGVC
                                            : ::*.* ....*:: :  :     :*: *    : 

2785|gene|hut       GRMASRRRNGCVFDFGANYLEVADPDLEEVI-EDAAGEKLVEIEPPVWRFDAAGEITPGD
167|gene|hut        GRMVSAHREDCVYDYGANYVDPPNDRVEERF-RSVVGDRLAETTGDVWVFDESGEVEEGR
10970|gene|hma      GRAATRRHGDCTYEYGANYLKADDGRVTELVTETLPTEGLVDIEEPVYAFDRTGDIGTGR
1599|gene|hhi       GRAATRRHGDCTYEYGANYLKADDGRVTELVTEALSTEGLVDIEEPVHAFDRTGEIDAGR
1925|hp|hla         GRAATRRHGELTYDYGANYLKADDDRVVELITETLDSEGLVDIAEPIYVFDADGEVSPGR
3824|hp|nph         GRAATRRHDDLVYDYGANYVKSDDDRVVDLLTETLDTDGLVDVSEPIYTFDESGAVAPGR
622|hp|nrc1         GRAATRRKDGCRYDHGANYVKPGDGPVAELV-HALGDDGLVDVTAPVWTFTGDGELSPGR
3119|gene|hwa       GRAATRRKNGCRYDHGANYIKDADPRTAELI-PTLGTEELVDIDEPVWTFDETGEITEGD
6680|hp|hbo         GRAATRRKHDCYYDHGANYIKESDQRTESLI-RDLGTDGVVDIEKPVWVFDESGEITEGD
                    ** .: ..    ::.****:.  :    . .      : :.:    :  *   * :  * 

2785|gene|hut       TPQNSRWTGRGGLDEIVRGMINASGATLEDGVGVTHLERLD--DG-WRVTTEAGER--EF
167|gene|hut        PNQGVKLSGRDGIDEIVRAFLDASDATVQEQTAVNRLARTA--DG-WAV-TADGERLAS-
10970|gene|hma      DADEHKWTYEAGITQVAKRLFNEADADVENGVRVERLERQR--DG-WRLEDDEGADLGHF
1599|gene|hhi       DADEHKWTYEAGITQLAKRLFDETDADVENGVRVERLERQR--DG-WRLEDDDGADLGHF
1925|hp|hla         DADEHKWSYRQGLTQIAKRLFARTDATVHRRTRIETVRRVG--DR-WEVDDASGVTRGPF
3824|hp|nph         SADDHKWSYERGLTQVAKRLFGATDATVHRRTRVESLARTE--EG-WTIEDTDGDSWGPF
622|hp|nrc1         GDDDPKWTWEAGITQLAKRLFAATDATVQTETRVETLARTD--DGDWTVATDGGTRHTGF
3119|gene|hwa       SRDEHKWTWTEGMTQLAKRLFAETDVNINHRTRVADISRVE--KA-WTLTDTDNTDYGPF
6680|hp|hbo         DGDSHKWTWTEGITQLAKRLLARTDAEVRRETRVESIVCDDSEAT-WSLIDTEGETHGPF
                      :  . :   *: ::.. ::  :.. :   . :  :         * :    .      

2785|gene|hut       DAIVLAVPTASASVLLETADWDAPLREELAIEINQIPYRTMDTVALHFAFELETPYFGLV
167|gene|hut        DAVVVTPPA---GDLLAKADWEADFRETLVAARQRQSYRTIDSVALHYPFEMDVPYYALV
10970|gene|hma      DAALLTPPAPQTADLLGQSRWDHDDCRELRQEIAAVPYRTVISGVLHYPFELDVPWYAAV
1599|gene|hhi       DAALLTPPAPQTADLLGQSRWDHDDCRALRQEIASVPYRTVIAGVLHYPFEIDVPWYAAV
1925|hp|hla         DALLLNPPAPQTADLLRSAEWDSPVREALVDAVGDVAYRTVWTAVLHYPFPLDVPYYGLV
3824|hp|nph         DVVGLNPPAPQTAELLAATDWDDKRLATLQEAVKSVEYRPIWTAVLRYPFRLDRPYYALV
622|hp|nrc1         DDVLLTPPAPQTATLLSSTDWADDRRDALRAAAADVSYRSIVTAVLHYPFELDREWYGLV
3119|gene|hwa       DALLLTPPAPQTVTLLEATAWQDTRLETLMSAAADVEYRTIRTVVLHYPFMESYPWYGLV
6680|hp|hbo         DRLLLTPPAPQTAEILRATEWDGERLGDATAAVSDVSYRTIRTFVLHYPFREEYSWYGLV
                    *   :  *:     :*  : *                **.: : .*.:.*  .  ::. *

2785|gene|hut       SEESVYDVAWVSNERHKPGHVPDGETVIVVQFGPSWVVTHPQTSPAAASEAATHRARELI
167|gene|hut        NTDKEHAVGWLSRESCKPGHVPDGEEILIVQLSPAWAAGRPDATPAEAADAASTHAATLL
10970|gene|hma      NSDKEHDIGWVGREECKDGHVPDGESLLLVQMNEPWSIANYDEHPDTLIDDIASRTARLL
1599|gene|hhi       NSDKDHDIGWVGREECKDGHVPDGESLLLVQMNEPWSIANYDEHPDTLVDDIATRTARLL
1925|hp|hla         NTDKAHAVGWLSRDECKSGHVPDGETLLIVQANHEWSVEHYDADPAENVAMLAEHAADIV
3824|hp|nph         NPGKDHDVGWIAREECKRGHVPDGESLLVVQASAQWSAANYDADPAENVAELASLTADIV
622|hp|nrc1         NTDDGHDIGWLSREACKAGHVPDGEEILIVQMAPDWSREHYDHPASKQATVAARAAGVLL
3119|gene|hwa       NVDKEHPVGWLSREECKDGHVPAGESLFIAQMSPEWSTNRYDDPVDVAGADTASHVAALL
6680|hp|hbo         NVDKAHEVGWVSREECKDGHVPDGESLLIAQMSPEWSAERYDDPLAEAGDDAAALVAELL
                    .  . : :.*:..:  * **** ** :::.*    *   . :          :  .  ::

2785|gene|hut       GDDRLVDPNWWEYQRWGDAIPTRSPDEELIEQALDSDLAIAGDWVTGIGRTRSALRSGLK
167|gene|hut        ADDRLAEPDWWDHERFRYALPGDRVNPALFEQALEHDLGLAGDWLAGTGRTHAALETGLE
10970|gene|hma      DDDRLADPDWTDHQHWRYSQPEGEVDHDLLSCAAEHDLHFAGDWVAGEGRLHAALRNGLE
1599|gene|hhi       DDDRLADPDWTDHQHWRYSQPEGKVDHDLLACAAEHDLYFAGDWVAGEGRLHAALRNGLE
1925|hp|hla         GDDRLADPAWTDYQGWRYAQPETGVDRGPLDSACQEGLYLLGDWVAGEARVHAALANGLD
3824|hp|nph         GDERLAEPVWTDHQGWRYALPEDGVRRGPVSAAAEAGLYCLGDWVAGEGRLHAALAEGLA
622|hp|nrc1         DDDRLADPDWTDTQGWRYAIPNDAVAGAPVDAAREAGLHVAGDWVAGDGRVHAAVEAGLA
3119|gene|hwa       DDERYENPDWIDDQGWRYALPENGIDNRAARVAESAGLYIAGDWIVGEGRVNKALWNGYD
6680|hp|hbo         DDDRYADPDWVDDQGWRYALPNDGVDTDAVRATEDAGLFFAGDWVVGEGRVHHALWNGHE
                     *:*  :* * : : :  : *           : . .*   ***:.* .* . *:  *  

2785|gene|hut       AGRNLQ---------
167|gene|hut        AGRRLSTRL------
10970|gene|hma      TGEAIADSR------
1599|gene|hhi       TGEAIADSG------
1925|hp|hla         VGERVADGV------
3824|hp|nph         VGEQIVHAQ------
622|hp|nrc1         AADHITRG-------
3119|gene|hwa       TGTRIANALSLSQRS
6680|hp|hbo         AAERIVGRAE-----
                    ..  :