HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0689arCOG02453hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0689 nrc1 VNG2400 vng2400 no entry
nucHOG0689 hmu HMUK1130 Hmuk_1130 conserved hypothetical protein
nucHOG0689 hma RRNAC2575 hypothetical protein
nucHOG0689 hwa HQ3734A hypothetical protein
nucHOG0689 hla HLAC2740 Hlac_2740 hypothetical protein
nucHOG0689 hbo HBOR02040 Hbor_02040 hypothetical protein
nucHOG0689 hut HUTA2252 Huta_2252 conserved hypothetical protein
nucHOG0689 hvo HVO_0017 HVO_0017 conserved hypothetical protein
nucHOG0689 nph NP1236A hypothetical protein
nucHOG0689 hhi 2999 HAH_2999 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2400|hp|nrc1      MIKMTGALRHGMDYELAIEGTPDAVPGGTVALLIHPSTGATDRMDTDFLKADTDHFLVVS
1236|hp|nph       -----------MDYELAIENTPETVPAGTGILLIHPSTGETDRIDTDFFKTDTDRLFVIS
3734|hp|hwa       -----------MEYGLAIESAPESIPAGTGVLLLHPSIGETDRIDTDFLKTDTDNFLVIS
2740|hp|hla       -----------MDYSLAIENGPETIPGGTGLLLVHPSIGETDRIDTNFLKTDTDAFLVVS
2040|hp|hbo       -----------MDYTLAIENTPDTIPGGTGILLLHPSIGETDRIDTDFLKTDTDHFLVVS
2252|chp|hut      -----------MDYTLAIDDAPETVPGGTSILLIHPSTGETDRVDTDFLSTDTDHFLVVS
12575|hp|hma      -----------MEYTLAIDNAPETVPGGTGVLLLHPSTGETDRLDTDFLATDTDSMLVIS
2999|hp|hhi       -----------MEYTLAIDNAPETVPGGTGVLLLHPSTGETDRLDTDFLATDTDSMLVIS
                             *:* ***:. *:::*.**  **:*** * ***:**:*: :*** ::*:*

2400|hp|nrc1      TRTTAREVTQKLEYYDVDEDRAEILDTLSVEHGYSRRAASHIRYVSRPGDVDGILASIDE
1236|hp|nph       TRTTAREVQQKLEYYDVDESTAEILDTLSVERGYSRRSSDRVHYVSAPDDLDGIVETTRQ
3734|hp|hwa       TRTTAREVNQKLEYYDVDESRAVILDALSVERGYSRRESDRVHYISAPDDLDGIVDRTDE
2740|hp|hla       TRTTAREVEQKLEYYDVDETKATILDTLSVERGYSRRSSDDVYYVSAPDDLDGVVDRVER
2040|hp|hbo       TRTTAREVEQKLEHYDVDESRAVILDTLSVDRGYSRRGSNHVHYVSAPDDLDGIVEQVRN
2252|chp|hut      TRTTAREVSQKIEHYEVDERKATILDALSVERGYTRRRSDDVRYVSAPDDFDGIVAETRE
12575|hp|hma      TRTTAREVKQKLEYYEVDESKATILDTLSVERGYTRRQSESVRYVSAPDDLSGIVSEAET
2999|hp|hhi       TRTTAREVKQKLEYYEVDESKATILDTLSVERGYTRRRSEGVRYVSAPDDLSGIVSETET
                  ******** **:*:*:***  * ***:***:.**:** :. : *:* *.*..*::     

2400|hp|nrc1      FLTDTDGKRRVSFDSLTELAYYADEHQALDALQRLRGIVERHDATALVHVSAEVHDEDAL
1236|hp|nph       FLDENEGKRRISLDSVTEMAYYADEERALEAVGELLELLAEYDAVGLFHLSEEVHDDADV
3734|hp|hwa       FLTKYDGKCRISLDSVTELAYYADVDGAYEATDKLLKLLVENDAVGLFHLSKEVHETATI
2740|hp|hla       FLTEHEGKRRVSVDSLTEMAYYADDDAVYEAAADILDLLDEHDAVGIFHLSEEVHEVATL
2040|hp|hbo       FLESHDGKLRVSVDSVTELAYYADVDRAYEATKRLLDLLDEHDAVGLFHLSNEVHEEPTL
2252|chp|hut      FLSTTEGKRRISVDSLTEMLYYADEPQTTAAVEQLLALLADHDAVGLFHLARGVHDEDRL
12575|hp|hma      FLQEHDGKLRVTFDSLTELIYYADEDGALSAVEDILDLLDEYDAVGMFHLADEVHDEETV
2999|hp|hhi       FLQEHDGKLRVTFDSLTELIYYADEDGALSAVEDILDLLAEYDAVGMFHLADEVHDEETV
                  **   :** *::.**:**: ****   .  *   :  ::   **..:.*::  **:   :

2400|hp|nrc1      SRFRDAGDLVVELDADGTVRTDR--
1236|hp|nph       EAFKELFDGIVYLEEDGTVESQF--
3734|hp|hwa       ERFRNRFDAVVELGVDGNVTVDF--
2740|hp|hla       DRFRDLFEGVIELDGDGNVTVDV--
2040|hp|hbo       ERFRELFEGVVELDVGGNVSSEF--
2252|chp|hut      DRFRSLFDGVIELETDGSMTASF--
12575|hp|hma      AAFRELFDGVIELSEDGTITSTFEA
2999|hp|hhi       AAFRELFDGVIELSEDGTITSSFEE
                    *..  : :: *  .*.: