HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0686COG2009KOG0449arCOG02244Succinate dehydrogenase/fumarate reductase cytochrome b subunitsuccinate dehydrogenase subunit C

HOG Organism Gene ID Name Annotation
cHOG0686 nrc1 VNG1310 sdhC succinate dehydrogenase subunit C
cHOG0686 hmu HMUK2076 Hmuk_2076 succinate dehydrogenase, cytochrome b556 subunit( EC:1.3.99.1 )
cHOG0686 hma RRNAC1091 hypothetical protein
cHOG0686 hwa HQ2997A sdhC succinate dehydrogenase, subunit C (cytochrome b-556)
cHOG0686 hla HLAC1987 Hlac_1987 succinate dehydrogenase, cytochrome b556 subunit
cHOG0686 hbo HBOR12900 Hbor_12900 succinate dehydrogenase subunit C( EC:1.3.99.1 )
cHOG0686 hut HUTA2835 Huta_2835 succinate dehydrogenase, cytochrome b556 subunit
cHOG0686 hvo HVO_2811 HVO_2811 sdhC succinate dehydrogenase subunit C
cHOG0686 nph NP4270A sdhC succinate dehydrogenase, subunit C (cytochrome b-556)
cHOG0686 hhi 1703 sdhC succinate dehydrogenase subunit C (cytochrome b-556)
MUSCLE (3.6) multiple sequence alignment


10910|hp|hma        MKRLRQPGVQAGLVALLGGVVVFALAHVVFPHHTTNHDEGVYLQQAAMLLEGQLFIYPPV
2835|gene|hut       --------------------------------MAQTYDRGAV------------------
4270|gene|nph       --------------------------------MSQSYDRGLV------------------
1310|gene|nrc1      ----------------------MCGQSRPLVGMSESYDRGLV------------------
1987|gene|hla       --------------------------------MSQSYNRGLI------------------
1703|gene|hhi       --------------------------------MSQSYNRGTV------------------
2997|gene|hwa       --------------------------------MSQSYNRGLV------------------
12900|gene|hbo      --------------------------------MSQSYNRGLI------------------
                                                     : .:: *                    

10910|hp|hma        KESFRPWFFVADGERLYPKYAPVPAAMFAVGKLLGGYRVALGLISTGALALTYHTVREAF
2835|gene|hut       -EDFGRW-----------------------------------------------------
4270|gene|nph       -EDFGRW-----------------------------------------------------
1310|gene|nrc1      -ADFGRW-----------------------------------------------------
1987|gene|hla       -EDFSRW-----------------------------------------------------
1703|gene|hhi       -EDFGRW-----------------------------------------------------
2997|gene|hwa       -EDFGRW-----------------------------------------------------
12900|gene|hbo      -EDFGRW-----------------------------------------------------
                      .*  *                                                     

10910|hp|hma        DARTGVVASVLMLGSPLFLIDASVFLSYVPATLWNLGFAAAYLHADRTGSRKTAACAGLS
2835|gene|hut       ------------------------------------------------------------
4270|gene|nph       ------------------------------------------------------------
1310|gene|nrc1      ------------------------------------------------------------
1987|gene|hla       ------------------------------------------------------------
1703|gene|hhi       ------------------------------------------------------------
2997|gene|hwa       ------------------------------------------------------------
12900|gene|hbo      ------------------------------------------------------------
                                                                                

10910|hp|hma        IGLAFFARPYTAVLFATPFIIHALWSLRTRDPARFTRLSLTAVGGLTGVAATLAYNHVVT
2835|gene|hut       ------------------------------------------------------------
4270|gene|nph       ------------------------------------------------------------
1310|gene|nrc1      ------------------------------------------------------------
1987|gene|hla       ------------------------------------------------------------
1703|gene|hhi       ------------------------------------------------------------
2997|gene|hwa       ------------------------------------------------------------
12900|gene|hbo      ------------------------------------------------------------
                                                                                

10910|hp|hma        GSAMLFPYEVFAPQDGPGFGYREILGYSREFTPAMSLDANTELLWKLVTQWVVAGPLGTV
2835|gene|hut       ----------------------------REFSAGMW-----AWLLHKFTGWVLVG-----
4270|gene|nph       ----------------------------QEFSAGMW-----AWIFHKFTGWVLIG-----
1310|gene|nrc1      ----------------------------TEFSAGMW-----AWVFHKFTGWVLVG-----
1987|gene|hla       ----------------------------REFQAGMW-----AWIFHKFTGWVLIG-----
1703|gene|hhi       ----------------------------REFTAGMW-----AWIFHKFTGWVLVG-----
2997|gene|hwa       ----------------------------REFSAGMW-----AWVFHKFTGWVLVG-----
12900|gene|hbo      ----------------------------KEFSAGMW-----AWIFHKFTGWVLVG-----
                                                 ** ..*        : : .* **: *     

10910|hp|hma        AAAIGLGAVVRRGIDGRQAALAGVLLTVPLGNGYFWGTVNMLGDLSDPTDGLVTF---LG
2835|gene|hut       ---------------------------------YLFTHIAVLSTAT------------GG
4270|gene|nph       ---------------------------------YLFTHVAVLSTAT------------VD
1310|gene|nrc1      ---------------------------------YLFTHISVLSTSL------------QG
1987|gene|hla       ---------------------------------YLFTHIAVLSTAIPAADGATMLFQGSE
1703|gene|hhi       ---------------------------------YLFTHIAVLSTAVGVDPASAQ----AG
2997|gene|hwa       ---------------------------------YLFTHIAVLSTAL------------QS
12900|gene|hbo      ---------------------------------YLFTHIAVLSTAL------------TG
                                                     *::  : :*.                 

10910|hp|hma        PFYHVDMLVPLTAFGAVGVVTVAQWTRRLVTERVSADRVRPVLLTVALCGAALGGGAAVT
2835|gene|hut       EELYNATLQGLEALAIVRLLEVG-------------------LLAVAV------------
4270|gene|nph       AATYTQTLQGLESLLVVRFLEVG-------------------LLAVAV------------
1310|gene|nrc1      AQVYNSTLSGLESLAIVRLLEVG-------------------LLAVAV------------
1987|gene|hla       TDVFTGTIVSLEGLLLVRILEVG-------------------LLAVAV------------
1703|gene|hhi       SDLYTSTISGLESLLIVRFLEVG-------------------LLAVAV------------
2997|gene|hwa       PEAYTTTIQSLESLLIVRLLEVG-------------------LLAVSV------------
12900|gene|hbo      QAEYTNTIQTLESLLVVRILEVG-------------------LLAVAV------------
                       .   :  * .:  * .: *.                   **:*::            

10910|hp|hma        TAAEPVSDNYEVTQQFEQAYEPFEERDLDNSLVLLPTPYGDWLNHPFQSVRNDPGFNGDT
2835|gene|hut       ------------------------------------------------------------
4270|gene|nph       ------------------------------------------------------------
1310|gene|nrc1      ------------------------------------------------------------
1987|gene|hla       ------------------------------------------------------------
1703|gene|hhi       ------------------------------------------------------------
2997|gene|hwa       ------------------------------------------------------------
12900|gene|hbo      ------------------------------------------------------------
                                                                                

10910|hp|hma        VYAMQHRQFEVIDAYPDRTYYRYVFRGEWVPYLGLPVEPRLQPVSVAEGETVRTDVSAAV
2835|gene|hut       --------FHILNG----------------------------------------------
4270|gene|nph       --------FHILNG----------------------------------------------
1310|gene|nrc1      --------FHILNG----------------------------------------------
1987|gene|hla       --------FHMLNG----------------------------------------------
1703|gene|hhi       --------FHILNG----------------------------------------------
2997|gene|hwa       --------FHILNG----------------------------------------------
12900|gene|hbo      --------FHILNG----------------------------------------------
                            * :::.                                              

10910|hp|hma        PEQAALVSMRLTSEGENDYATVTGADRLDLQLSTDQNRTRLTGDGIDEQVGVPTPEDGSV
2835|gene|hut       --------IRL-------------------------------------------------
4270|gene|nph       --------IRL-------------------------------------------------
1310|gene|nrc1      --------IRL-------------------------------------------------
1987|gene|hla       --------TRL-------------------------------------------------
1703|gene|hhi       --------IRL-------------------------------------------------
2997|gene|hwa       --------LRL-------------------------------------------------
12900|gene|hbo      --------LRL-------------------------------------------------
                             **                                                 

10910|hp|hma        TLIMFVDYGTGAGFEYRAELPVAQTDGGVRTLTPRLEVCKDQRRCDGEAAYVPGAHRDGI
2835|gene|hut       ---LFIDLGLGLERQDQSFYASLVITGAIAVASV--------------PTFLGGL-----
4270|gene|nph       ---LFVDLGVGLEAQDKAFYAALIVTAAITVASI--------------PTFLMGAF----
1310|gene|nrc1      ---LFVDLGVGLEAQDKSFYASLVLTGVIVVASV--------------PTFLTGAF----
1987|gene|hla       ---LLVDLGVGLEAQDKSFYASLILTGAITVASI--------------PTFIAGAF----
1703|gene|hhi       ---LMVDLGVGLESQDKSFYASLLLTGAIVVASV--------------PTFLGGKLA---
2997|gene|hwa       ---LFVDLGVGISGQDQSFYASLILTGAIVIASV--------------PTFLAGVFG---
12900|gene|hbo      ---LLVDLGVGLHAQDKSFYASLALTGAIVVASV--------------PTFVAGVF----
                       :::* * *   : .:  .     . :   :               .::: *      

10910|hp|hma        GMNATTTAENT
2835|gene|hut       -----------
4270|gene|nph       -----------
1310|gene|nrc1      -----------
1987|gene|hla       -----------
1703|gene|hhi       -----------
2997|gene|hwa       -----------
12900|gene|hbo      -----------