HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0685COG1938arCOG00347Archaeal enzymes of ATP-grasp superfamily3-isopropylmalate dehydratase

HOG Organism Gene ID Name Annotation
cHOG0685 nrc1 VNG0500 ppd 3-isopropylmalate dehydratase
cHOG0685 hmu HMUK2829 Hmuk_2829 protein of unknown function DUF75
cHOG0685 hma RRNAC0629 hypothetical protein
cHOG0685 hwa HQ2638A hypothetical protein
cHOG0685 hla HLAC1486 Hlac_1486 protein of unknown function DUF75
cHOG0685 hbo HBOR16220 Hbor_16220 ATP-grasp superfamily enzyme
cHOG0685 hut HUTA0342 Huta_0342 protein of unknown function DUF75
cHOG0685 hvo HVO_1593 HVO_1593 ppd 3-isopropylmalate dehydratase
cHOG0685 nph NP4074A hypothetical protein
cHOG0685 hhi 1287 HAH_1287 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


500|gene|nrc1       ------------MGSVTTHT---AFDIEDPVLIEGLPGVGLVGKIATDHIIDVFDMSCVG
4074|hp|nph         ------------MASVQIHND--DIQLESPVFVEGLPGAGLVGKIAADHLIETFDMDYYA
342|hp|hut          ------------MAQITVHET--ELSLSNPTLVEGLPGVGLVGKITADHLIETFEMTHYA
10629|hp|hma        MAFKPSADDIRGMAHIQVHRE--DMSLDSPTLIEGLPGVGLVGKIAADHLVDVYDMEYYA
1287|hp|hhi         MAFKPPAADTTDMAHIQVHRD--DISLDSPTLVEGLPGVGLVGKIAADHLVDVYDMEYYA
1486|gene|hla       ------------MARISVIDD--EISLDEPTLVEGFPGVGLVGKIATDHMIEAHEMVHYA
2638|hp|hwa         ------------MAQLEILTNATDISLIDPSLIEGFPGIGLVGKIAADHLVAEFEMTHYA
16220|gene|hbo      ------------MAKIAVLDD--SVSLSEPTMVEGLPGVGLVGKIAADHLVEAFDMVHYG
                                *. :        ..: .* ::**:** ******::**::  .:*   .

500|gene|nrc1       SVSCAAIPQVTVYTEDSHAATPPVRIYADESRGLLALQGDVPISRNNGTEFADCVTGWID
4074|hp|nph         AFHCEGLPQAAVYEAEKSVVRPPVRLYADSDRDIVVLQSDVPVSPTQASEFAGCVTGWIQ
342|hp|hut          TCHCKGLPEVAIYHENDPEITGAVRLYADPEHELLVLQSDVPVSPNAAEEFAGCLTGWIR
10629|hp|hma        SAHCEGLPEIAVYGTDDPEVRPPVRLYADEDRDLLVLQSDAPISPSGATEFAGCMVSWFE
1287|hp|hhi         SAHCEGLPEIAVYGTDDPDVRPPVRLYADEGRDLLVLQSDAPISPSGAKEFAGCMVSWFE
1486|gene|hla       NVHCDGLPRVTVYREGNRALTTPVRLYVDEERDLVALRSDVPVNPGAATEVAGCLESWFT
2638|hp|hwa         DVHCETIPAVAVYQEDDPALRSPVRLYVDVDRDLAVLQSDVPISPEAATEVATCLSEFID
16220|gene|hbo      NLHCDGIPKVAVYHEGDPELSTPVRLYADAERDLLVLQSDVPIVPQAATEVANCLSSWFD
                       *  :*  ::*   .     .**:*.*  . : .*..*.*:    . *.* *:  :: 

500|gene|nrc1       HHDVTPVYLSGLPSDDHELGDLPTVFGIGSGALPERIAALDIGTPPERGVIGGPTGALMT
4074|hp|nph         STDALPLYLSGLAEEK-E--GVPELYGVATGDAEPVLDDAGIVPPRGGGMVTGPTGALLH
342|hp|hut          DQDALPIYLSGRSTDP-D--DERATYGVATGEAGEILSAHDIAPPDERGAISGPTGALLY
10629|hp|hma        ANDATPVYLSGRPAEK-D--GVPDVYGISTGDGAAMLAEADVDPPSENGAITGPTGALVH
1287|hp|hhi         ANDATPIYLSGRPAEK-D--GLPDVYGVSTGDGAAMLEEANVDSPSENGAITGPTGALVH
1486|gene|hla       ETATFPIFLSGLGREKDE--APPDLYGVATGSGGDALSRADIEDPPESGLISGPTGAMLA
2638|hp|hwa         ETAMTPIYLSGIPKEKTE--TVPSLYGFGVSEGVNQVQKADIALPDETGLISGPTGALLS
16220|gene|hbo      DIESMPIFLSGLPQEKSE--DVPALYAVAAGEGAAMVEEAGIDFPNEMGLISGPTGALLH
                         *::***   :  :       :... .     :   .:  *   * : *****:: 

500|gene|nrc1       AATQRQLDAAALVVESDPQFPDPAGARRLIDHAIEPLVEVSVPTDDLVDRAADIRSQKEQ
4074|hp|nph         RAAEEAIDAVGLIVQTNPQFPDPEAARVILEHGVEPIAGIDVETDELVDRADEIQQAREQ
342|hp|hut          EAHRQDLDALGLIVEASARFPDPAAATSLIETAIAPITGLTVETDSLLDRAEEIRATRQQ
10629|hp|hma        ESQRTGLTSVGLIVEADQRFPDPEAARALLQTAISPLADFDIDTEALVEQAEEIGRAKAQ
1287|hp|hhi         ESQRVGLTSIGLIVEADQRFPDPEAARALLQTAISPLADFEVDTEALVEQAEEIGRAKAQ
1486|gene|hla       ESLERGRDAVGLVVESDPQFPDPEAARVLIRKGIDPIAGTETTTEGLVDQATEIRDAKQA
2638|hp|hwa         DAVMSDRDAIGLVVESDPQFPDPEAARVLINRGIEPLTSIDVPVNDLVDRTEQIREAKER
16220|gene|hbo      DALKNDRTAVGLIVESDPQFPDPEASRVIIKKGIEPLAGIEVPVDNLVDRAEEIRNAKKQ
                     :      : .*:*::. .**** .:  ::  .: *:.     .: *::.: :*   .  

500|gene|nrc1       LAEQMQHADEHESTQAKPLRMFQ
4074|hp|nph         LAKRVQEAANEESTAAQPIRGFQ
342|hp|hut          LAQRMQQAQE-ESSKAEPVGMYQ
10629|hp|hma        LAQQLQENQE-ESTSAQPLGMYQ
1287|hp|hhi         LAQQLQENQE-ESTSAQPLGMYQ
1486|gene|hla       FAKQMQEATE-ESSQAEPLKMFQ
2638|hp|hwa         LAKQMQEGGE-ESTQARPIGMYQ
16220|gene|hbo      LAQRMQQGDE-ESTQAQPLRMYQ
                    :*:.:*   : **: * *:  :*