HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0683COG1405 COG1019KOG1598 KOG1597 KOG3351arCOG01223transcription initiation factor IIB -like homolog

HOG Organism Gene ID Name Annotation
cHOG0683 nrc1 VNG1390 tfl transcription initiation factor IIB -like homolog
cHOG0683 hmu HMUK2242 Hmuk_2242 Transcription factor TFIIB cyclin-related
cHOG0683 hma RRNAC0869 transcription factor TFIIB
cHOG0683 hwa HQ2564A tfbA transcription initiation factor TFB
cHOG0683 hla HLAC1043 Hlac_1043 transcription initiation factor TFB
cHOG0683 hbo HBOR15480 Hbor_15480 transcription initiation factor TFIIIB, Brf1 subunit/transcription initiation factor TFIIB
cHOG0683 hut HUTA0402 Huta_0402 Transcription factor TFIIB cyclin-related
cHOG0683 hvo HVO_1664 HVO_1664 putative transcription factor tfiib repeat
cHOG0683 nph NP3718A tfbA_4 transcription initiation factor TFB 4
cHOG0683 hhi 1507 HAH_1507 transcription factor TFIIB
MUSCLE (3.6) multiple sequence alignment


1390|hp|nrc1        MYRAGDERAHDDRLTELAGIAADLELTAEAESTAKDLFLSTVDGAAPRSEPAVLAASVYA
1043|gene|hla       MYRASDRVDNAAWIDRLDDACATLDLDEETLSTATDLFLSRAPDDE-RGKRVAAAGSLYA
2564|gene|hwa       MYSARDRVENESWLEEIRTAAVTLNLSSETQTVAEDLFLSQAPDSD-RSKRAIAAASLYA
15480|gene|hbo      MYSARDRVDNEEWLTRIEEAADRLELGSEARSYASDMFLSQVPDAD-RSKRAVAAASLYA
3718|gene|nph       MYRARDHVENEQWLAAIDDAAERLDLGSEAKSRATDLFLSTVPEED-RSKQAVVAASLYA
402|gene|hut        MYRARDQVDNEKWVEAIETIGDRLDLSETARSRATDVFLSNVPEKD-RSKRAVLAASVYV
10869|gene|hma      MYRASDRIEHDEWLSDIEAASDRLDLGTAARSHAVDLFLSTVPEED-RSKQATMAASVYV
1507|gene|hhi       MYRASDRIEHDEWLSDIEAASDRLDLGTEARSHAVDLFLSTVPDED-RSKQATMAASVYV
                    ** * *   :  .:  :      *:*   : : * *:*** .     *.: .  *.*:*.

1390|hp|nrc1        GALIAGDQRSQTAVADAAGVSRLVIQERWKQLLARAGFDPPTW
1043|gene|hla       AALIRGQERSQSAVADAMDVSRLSVQKRWKPILEDAGFSPPTW
2564|gene|hwa       GTLITGSERSQSAVADAMNVTRLSVQQHWKGILNTAGFQPPSW
15480|gene|hbo      GALIAGEERSQSRVANAMDVTRLSIQQRWKEILEANGFRPPTW
3718|gene|nph       GALIAGDQRSQSDVADAVGVSRLTVQNRWRELLSEAGLEPPQW
402|gene|hut        GALVAGERHSQSAVAEATDVSRLTIQQRWKTLLEETGFDAPDW
10869|gene|hma      GALVAGEERSQSAVAEATDVSRLTIQQRWKDLLETAGLEAPGW
1507|gene|hhi       AALVAGEERSQSAVAEATGVSRLTIQQRWKDLLETAGLEAPGW
                    .:*: *. .**: **:* .*:** :*:.*. :*   *: .* *