HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0679COG2093arCOG04077DNA-directed RNA polymerase subunit E''DNA-directed RNA polymerase subunit E''

HOG Organism Gene ID Name Annotation
cHOG0679 nrc1 VNG2051 rpoE'' DNA-directed RNA polymerase subunit E''
cHOG0679 hmu HMUK0727 Hmuk_0727 DNA-directed RNA polymerase subunit E, RpoE2( EC:2.7.7.6 )
cHOG0679 hma RRNAC2830 rpoE'' DNA-directed RNA polymerase subunit E''
cHOG0679 hwa HQ1338A rpoE2 DNA-directed RNA polymerase subunit E''
cHOG0679 hla HLAC2395 Hlac_2395 DNA-directed RNA polymerase subunit E, RpoE2
cHOG0679 hbo HBOR05030 Hbor_05030 DNA-directed RNA polymerase, subunit E''( EC:2.7.7.6 )
cHOG0679 hut HUTA2206 Huta_2206 DNA-directed RNA polymerase subunit E, RpoE2
cHOG0679 hvo HVO_1898 HVO_1898 rpoE DNA-directed RNA polymerase subunit E.
cHOG0679 nph NP5078A rpoE2 DNA-directed RNA polymerase subunit E''
cHOG0679 hhi 109 rpoE'' DNA-directed RNA polymerase subunit E''
MUSCLE (3.6) multiple sequence alignment


2051|gene|nrc1      MASNRLACHDCHRIVE-PDEEMCPYCSSNSLTEDWAGYVVITHPDTSEIADKMEVHEAGE
2395|gene|hla       MAEDRLACRECHHVND-PDSQTCEHCGSSSLTEDWAGYVIITQPEESQIAEEMNVTKAGS
1338|gene|hwa       MVQTRLSCRECHYINH-ADSQTCENCGSSSLTEDWAGYVVVTHPDDSAIAEEMNVKEPGG
5030|gene|hbo       MAKPRLACRECHYINM-PDSQACENCGASSLTEDWAGYVVITHPEESDIATEMNVTEPGG
5078|gene|nph       -MADRLVCRDCHRVLEVDDGEQCPSCGSTSMTEDWAGYVVVAHPEDSRIAEEMGISEPGR
12830|gene|hma      -MADRLVCRDCHRVQSAEIESQCEACGGTALTEDWAGYVVIAHPERSDIAEEMEVTEPGK
109|gene|hhi        -MADRLVCRDCHRVQGAEIESQCEACGGTALTEDWAGYVVIAHPERSDIAEEMEVTEPGK
2206|gene|hut       -MADRYVCRECHRVQDNPEADVCQACGSSSLTEDWAGYVIITHPEESEIATEMEVTEPGK
                        *  *.:** :      . *  *...::********::::*: * ** :* : :.* 

2051|gene|nrc1      FALKVR
2395|gene|hla       YALKVR
1338|gene|hwa       YALKVR
5030|gene|hbo       YALKVR
5078|gene|nph       YALKVR
12830|gene|hma      YALKVR
109|gene|hhi        YALKVR
2206|gene|hut       YALKVR
                    :*****