HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0676COG0082KOG4492arCOG04133Chorismate synthasechorismate synthase

HOG Organism Gene ID Name Annotation
cHOG0676 nrc1 VNG1230 aroC chorismate synthase
cHOG0676 hmu HMUK2640 Hmuk_2640 chorismate synthase( EC:4.2.3.5 )
cHOG0676 hma RRNAC0124 aroC chorismate synthase
cHOG0676 hwa HQ3357A aroC chorismate synthase
cHOG0676 hla HLAC1114 Hlac_1114 chorismate synthase
cHOG0676 hbo HBOR19190 Hbor_19190 chorismate synthase( EC:4.2.3.5 )
cHOG0676 hut HUTA0181 Huta_0181 chorismate synthase
cHOG0676 hvo HVO_1306 HVO_1306 aroC chorismate synthase
cHOG0676 nph NP3082A aroC chorismate synthase
cHOG0676 hhi 876 aroC chorismate synthase
MUSCLE (3.6) multiple sequence alignment


3082|gene|nph       MNGNSFGRLFQVTTYGESHGDAMGVTVSGCPAGVELDEEAIQYELDRRKPGQSKITTSRG
3357|gene|hwa       MNGNRFGRMFQVTTYGESHGDAMGVTVSGCPAGLELEEADIQAELDRRKPGQSMITTSRG
19190|gene|hbo      MNGNRFGRLFQVTTYGESHGDAMGVTVSGCPAGLELDEDDVQKELDRRKPGQSMITTSRG
1230|gene|nrc1      MNGNRFGRLFEVTTYGESHGPGMGVVVSGCPAGVALDERMIQDELDRRKPGQSMITTSRG
1114|gene|hla       MNGNRFGRLFQVTTYGESHGEAMGVTVSGVPAGVELDEEAIQAQLDRRKPGQSMITTSRG
181|gene|hut        MNGNSFGRLFQVTTYGESHGEAMGCTVSGVPAGVELDEDDIQHDLDRRKPGQSMITTSRD
10124|gene|hma      MNGNEFGRLFRMTTYGESHGEAMGCTVSGVPAGVELSEEEIQKDLDRRKPGQSMITTSRG
876|gene|hhi        MNGNEFGRLFRMTTYGESHGEAMGCTVSGVPAGVELSAEEIQKDLDRRKPGQSMITTSRG
                    **** ***:* :******** .** .*** ***: *.   :* :********* *****.

3082|gene|nph       EPDEVTINSGTLEGYTTGTPIGMVIQNKDARSGKYEPFITAPRPSHGDFTYSAKFGTRNW
3357|gene|hwa       EPDAVEINSGVQDGYTTGTPIGMVIENKDARSGKYEPYVTAPRPSHGDFTYSAKFGTRNW
19190|gene|hbo      EPDAVVINSGTQDGYTTGTPIGMVIENKDARSGKYEPYVTAPRPSHGDFTYSAKFGTRNW
1230|gene|nrc1      EPDEVSIQSGLQDGYTTGTPIGMTIENKDAESGKYEPFVTAPRPSHGDYTYSAKFGTRNW
1114|gene|hla       EPDEVVVNSGVQDGYTTGTPIGMVIQNKDARSGKYEPYVTAPRPSHGDYTYSAKFGTRNW
181|gene|hut        EPDAVTINSGLQDGYTTGTPIGMVIQNKDSRSGKYEPFVTAPRPSHGDFTYSAKFGTRNW
10124|gene|hma      EPDKVTINSGIQDGYTTGTPIGMVIQNKDARSGKYEPFITAPRPSHGDYTYSAKFGTRNW
876|gene|hhi        EPDKVTINSGIQDGYTTGTPIGMVIENKDARSGKYEPFITAPRPSHGDYTYSAKFGTRNW
                    *** * ::**  :**********.*:***: ******::*********:***********

3082|gene|nph       GGGGRSSARETVNWVAAGAVAKQVLEQSEHDVEIKAHVNQIGDIEAPPVSFEEMVEHSEE
3357|gene|hwa       GGGGRSSARETVNWVAAGAIAQKILT--EYGIKAKAHVNQIGDIKAPPVTFEEMLEHTEE
19190|gene|hbo      GGGGRSSARETVNWVAAGAIAKQILE--AHDVQVKAHVNQIGDIEAPPVTFEEMLEHTEE
1230|gene|nrc1      GGGGRSSARETVNWVAAGAVAKAVLAQSDHDVRVKAHVNQIGEIEAPDVSFEDIREHSED
1114|gene|hla       GGGGRSSARETVNWVAAGAVAEQVLDASEYDVEIKAHVNQIGDVEADDVSFEQILDHSEE
181|gene|hut        GGGGRSSARETVNWVAAGAIAKQVLDQSEYDVQIKAHVNQIGEIEAPDVTFEEMLEHSEE
10124|gene|hma      GGGGRSSARETVNWVAAGGVAKQVLEQSDYDVQIKAHVCQIGDVEAGPVTFEDMLEHSEE
876|gene|hhi        GGGGRSSARETVNWVAAGGVAKQILEQSDYDVQIKAHVCQIGDVEAGPVTFEDMLEHSEE
                    ******************.:*: :*    :.:  **** ***:::*  *:**:: :*:*:

3082|gene|nph       NEVRCGHPETAARMRERIDEYQEAGDSIGGAIEFEVRGVPRGLGAPRFDSFEARLGKAML
3357|gene|hwa       NEVRCAHPETAERMRERIDEYQTEGDSIGGSIYFEARGVPAGLGAPRFDSLPARLGKAMF
19190|gene|hbo      NEVRCAHPETAEQMREKIDEYQEEGDSIGGSVYFETRGVPRGLGSPRFDSFSARLGQAMM
1230|gene|nrc1      NEVRCADPETAERMRALIDDYQERGDSIGGSIYFEARGVPRGLGAPRFDSVPARLGQALF
1114|gene|hla       NDVRCADPEAAAEMQELIERYQEAGDSIGGSIYFECRGVPRGLGAPRFDGFPSRLGQAMF
181|gene|hut        NDIRCAHPETAEEMRDLAEQYQQEGDSIGGSVYFECQGVPRGLGAPRFDSIPSRLGQLIY
10124|gene|hma      NEVRCADPEAAEEMRDVADQHQKEGDSIGGAIYFECRGVPSGLGAPRFDSFPSRLGQAMY
876|gene|hhi        NEVRCADPDAAKEMRDLADKHQKEGDSIGGAIYFECRGVPSGLGAPRFDSFPSRLGQAMY
                    *::**. *::*  *.   : :*  ******:: ** .*** ***:****.. :***: : 

3082|gene|nph       SVPATTAFELGLGREAREYTGSERNDEWAFDEGDR-PEAVSDEGDPVPVENDHGGLQGGI
3357|gene|hwa       SVPATTSVEYGLGHEAREWRGSNRNEDWEFDE----------DGNPIPEGNTHGGLQGGI
19190|gene|hbo      AIPAATAFEFGLGREAREWTGKDRNEDWTFDE----------DEDPVPVGNKHGGIQGGI
1230|gene|nrc1      AIPATTSVEFGLGRDARSVAGKQRNEDWTVADGDE-DHVVADEGDPIPAGNDHGGLQGGI
1114|gene|hla       SIPATTGVEFGLGKDAVNVTGSERNEDWTFDDGESFDHVESEEGDPVPVGNDHGGLQGGI
181|gene|hut        SIPAVNDFEYGVGRDARTMAGSEYNEDWEFDS----------NGDPVPVGNDHGGIQGGI
10124|gene|hma      SIPAVNDFEYGIGREARTTKGSEYTENWEFDE----------DGHPTPVGNDHGGIQGGI
876|gene|hhi        SIPAVNDFEYGIGREARTTKGSEYTENWEFSE----------DGHPTPVGNDHGGIQGGI
                    ::**.. .* *:*.:*    *.: .::* . .          :  * *  * ***:****

3082|gene|nph       TTGLPIYGEVTLHAPTSIPKGQQTADWETDEIVDDAQVIGRHDPVLPPRGVPVVEAMLYL
3357|gene|hwa       TTGQPIYGEATWHAPTSIPKEQQTVDWETGE-QKDIQVVGRHDPVLPPRAVPVVEAMLNI
19190|gene|hbo      TTGQPVFGEVTWHAPTSIPKEQTTVDWETGE-EKEIQVVGRHDPVLPPRAVPVVEAMLNL
1230|gene|nrc1      TTGEPIYGEASWHAPTSIPKTQATVDWETGE-EKAVTVTGRHDPSLPPRAVPVVEAMLYC
1114|gene|hla       TTGEPIYGEATWHAPTSIPKKQRSADWETGE-EKDVQVVGRHDPVLPPRAVPVVEAMLYC
181|gene|hut        TTGDPIYGEITWHPPVSIPKAQETVDWETGE-RKEIQVVGRHDPVLPPRAVPVVEGLLYC
10124|gene|hma      TTGQPIYGEVSWHAPVSIPKTQETVDWETGE-GKEITVTGRHDPVLPPRAVPVVEAMLAC
876|gene|hhi        TTGQPIYGEVSWHAPVSIPKTQKTVDWETGE-GKEITVTGRHDPVLPPRAVPVVEAMLAC
                    *** *::** : *.*.**** * :.****.*  .   * ***** ****.*****.:*  

3082|gene|nph       TVLDFMLLGGRINPDRIDDSPGEYDTDYHPSSPRNE--------------
3357|gene|hwa       TILDFMLLDGQINPDRLDDNPGQYETEYHPSSPQTN--------------
19190|gene|hbo      TIVDFMLLGGHINPDRMDGQVGEYDTEYHPQSPQNQ--------------
1230|gene|nrc1      TILDFMLLGGRINPDRLDGHPGQYDTDYHPSSPRNE--------------
1114|gene|hla       TVLDFMLLAGRINPDRVDGNPGQYDTDYHPSSPDND--------------
181|gene|hut        TVLDFMLLGGRINPDRLDGRPGEYDTDYHPSSPVNDPDDAATQAETIDDE
10124|gene|hma      TVLDFMLLGGRINPDRLDGRPGEYDTDYHPSSPQNDPEDADTHAKTIDDD
876|gene|hhi        TVLDFMLLGGRINPDRIDDRPGEYDTDYHPSSPQNDPEDADTHAKTIDDE
                    *::***** *.*****:*.  *:*:*:***.** .: