HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0675COG2125KOG1646arCOG01946Ribosomal protein S6E (S10)30S ribosomal protein S6E

HOG Organism Gene ID Name Annotation
cHOG0675 nrc1 VNG2514 rps6e 30S ribosomal protein S6E
cHOG0675 hmu HMUK0255 Hmuk_0255 Ribosomal protein S6e
cHOG0675 hma RRNAC2212 rps6E 30S ribosomal protein S6e
cHOG0675 hwa HQ1070A rps6R 30S ribosomal protein S6e
cHOG0675 hla HLAC2128 Hlac_2128 Ribosomal protein S6e
cHOG0675 hbo HBOR03790 Hbor_03790 SSU ribosomal protein S6E
cHOG0675 hut HUTA0937 Huta_0937 Ribosomal protein S6e
cHOG0675 hvo HVO_1827 HVO_1827 Ribosomal protein S6e
cHOG0675 nph NP1368A rps6R 30S ribosomal protein S6e
cHOG0675 hhi 2685 rps6E 30S ribosomal protein S6e
MUSCLE (3.6) multiple sequence alignment


937|gene|hut        MVDFTVAVADPDTGETHQVDIDGQDANRFVGRELGDEVEGSAIGLDGFTLELTGGSDDAG
1368|gene|nph       MADFQVVVGD-DDGTAYSFEVDGQDANRFIGRAIGETVDGDAVGLPGYELEITGGSDQSG
2514|gene|nrc1      MATFQVAVADPESGRTYQFEVDGQDANRFIGREIGAAVDGGAVGLDGYTVEITGGSDDAG
12212|gene|hma      MAEFTVAVSDPEDGHTYQIDVDGQDANRFIGRELGDEVDGGAVGLDGYSLELTGGSDTSG
2685|gene|hhi       MAEFTVAVSDPEDGHTYQIDVDGQDANRFIGRELGDEVDGGAVGLDGYTLELTGGSDTSG
2128|gene|hla       MAEFKVVIADPNTGETFQREVDGQDANRFLGRDIGDEIGGDAVGLSEHTIAITGGSDETG
1070|gene|hwa       MAEFKVVVSD-ETGHTRQFEVDEQDANRFLGRNLGNEVDGNAVGLDGATLELTGGSDDAG
3790|gene|hbo       MAEFKVVVSDPDAGDTHQFEVDGQDANRFLGRDIGDEVDGGAVGLDGFTLEITGGSDEAG
                    *. * *.:.* : * : . ::* ******:** :*  : *.*:**    : :***** :*

937|gene|hut        RPLRADVRGPNLKSILLEGGTGFSPERDGERKRVTVRGREISDAVRQLNVTIVEHGDGDV
1368|gene|nph       RPMHGDINGAETAAILSEGGVGFNPTVDGERKRVTVRGAEVSEDTRQINASIVSRGEQSI
2514|gene|nrc1      RPMREDVDGSDLMEVLLEGGAGFNPDEDGERKRVTVRGKEVSEAVAQLNVAIDEHGEEPV
12212|gene|hma      RPMRPDVRGVTTKEIMSDGGVGFEPTTDGERKRITVRGREVSDDTRQINAKITARGSDDV
2685|gene|hhi       RPMRPDVRGVMTKEIMSDGGVGFKPTTDGERKRITVRGREVSDDTRQINAKITARGSDDV
2128|gene|hla       RPMREDVSGTRLKELLLEGGVGFEPSREGERKRITVRGREIDNDVAQINVSVV--EGDDV
1070|gene|hwa       RPMREDVSGSDLKELLLEGGVGYEPTRDGERKRITVRGRQVSDETAQVNAAVV--GETPI
3790|gene|hbo       RPMRENVAGSNLKELLLEGGVGYKPSRDGERKRVTVRGRQVSDETAQVNAKVI--DGGDV
                    **:. :: *     :: :**.*:.*  :*****:**** ::.: . *:*. :       :

937|gene|hut        ADLLT-------------------------------------EE
1368|gene|nph       DDLLG----------------------------------GEDDE
2514|gene|nrc1      AELLG---------------------------------ADGDDE
12212|gene|hma      ADLLG-----------------------------------DDDE
2685|gene|hhi       AELLG-----------------------------------DDDE
2128|gene|hla       AAALG---------------------------EGDADADDADEE
1070|gene|hwa       AVLLGEEEPEDADDDGDSDVDADEATDTDAGSEEDNDDDIADAE
3790|gene|hbo       AAALG----------------------------EDDEEDEADEE
                       *                                       *