HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0674COG0479KOG3049arCOG00962Succinate dehydrogenase/fumarate reductase Fe-S protein subunitsuccinate dehydrogenase subunit B

HOG Organism Gene ID Name Annotation
cHOG0674 nrc1 VNG1308 sdhB succinate dehydrogenase subunit B
cHOG0674 hmu HMUK2078 Hmuk_2078 succinate dehydrogenase and fumarate reductase iron-sulfur protein( EC:1.3.99.1 )
cHOG0674 hma RRNAC1093 hypothetical protein
cHOG0674 hwa HQ2995A sdhB succinate dehydrogenase, subunit B (iron-sulfur protein)
cHOG0674 hla HLAC1989 Hlac_1989 succinate dehydrogenase and fumarate reductase iron-sulfur protein
cHOG0674 hbo HBOR12880 Hbor_12880 succinate dehydrogenase subunit B( EC:1.3.99.1 )
cHOG0674 hut HUTA2833 Huta_2833 succinate dehydrogenase and fumarate reductase iron-sulfur protein
cHOG0674 hvo HVO_2809 HVO_2809 sdhB succinate dehydrogenase chain B homolog
cHOG0674 nph NP4266A sdhB succinate dehydrogenase, subunit B (iron-sulfur protein)
cHOG0674 hhi 1705 sdhB succinate dehydrogenase subunit B (iron-sulfur protein)
MUSCLE (3.6) multiple sequence alignment


10930|hp|hma        ------------------------------------------------------------
2833|gene|hut       MSTDSNAE-TGTDAESTAETDVESGTDADAEPAVPEPDISSHQQRRMDEKREGMAERD--
1308|gene|nrc1      MSTK-PSQ-SETETETDTEP-ATTG----------------HQQRRLDDKRARADDRD--
1705|gene|hhi       MSTQIEQQETETEADEETEPEVESP----------------GDRRRAQRDERQAQEQA--
4266|gene|nph       MSTQVTEQ------EQETEPEQTSE----------------HQERRLSEKRERADMSE--
2995|gene|hwa       MSTQLPQQ-TEDETTT-SEVEKESS----------------PPQAPLTDPLSEIETDT--
12880|gene|hbo      MSTQVPEQ-VEDESSADTET---SA----------------AQQARMEKKRQKAEERE-R
1989|gene|hla       MSTQTPTQ-TEESTETDAETEVPSK----------------GDERREEKRRRAAEERTRR
                                                                                

10930|hp|hma        ----MTESAQDGE--------------------YDAWLDSIESG----DGYYLECSNGHG
2833|gene|hut       -AQAAAAAETDGETTHLRIFRYDPEVEGKSEPRFDDFQVPYEQGMTVLDALIYARDHFDS
1308|gene|nrc1      EAAAQAETEFDGETVELKVFRYDPEIAGKEEPRFDTFTVPFETGMTVLDALIFARDSYDS
1705|gene|hhi       QREVEEETLDDEDTITLKVFRYDPEIEGKQEPRFDDFSVPFHKGMTILDALIYARDHYDS
4266|gene|nph       --RAKSDLSDADETVQIKVFRYDPEVEGKKDPRFDTFEIPFTKGMTVLDALIYARDHFDS
2995|gene|hwa       ---EHDDSHEDEDTYVLKVFRYDPEIAAKQEPRFDDFHVPYHKGMTVLDALMYARDNYDS
12880|gene|hbo      QAEEAESAAAGEDTYLLKVFRYDPEVAGKQEPRFDDFHVPYHKGMTVLDALMYARDHYDS
1989|gene|hla       QAEEAEKAAADEETVELKVFRYDPEIEGKQEPRFDTFHVPFTKGMTVLDALMYSRDTYDS
                                :                    :* :  .   *    *.     .   .

10930|hp|hma        WLPPRRVCPR----------------CHDQDLSAVDLPESGEIASHTTI----TVPTPQF
2833|gene|hut       TLTFRHSCQQGVCGSDALFVNGSQYLGCKTQLNEFDEPVRIEPLPHQDVVKDLVVDMQHF
1308|gene|nrc1      SLTFRHSCRQAVCGSDAFFVNGSQRLGCQTQIEDLEWPVRVEPLPHSDVVKDLVVEMDHF
1705|gene|hhi       SLTFRHSCRQAVCGSDALFVNGRQRLGCKTQISELEDPVRIEPLPHQEVVKDLVVDMEHF
4266|gene|nph       TLTFRHSCRQAICGSDALFVNGAQRLGCKTQMVDLEWPVRIEPLPHAEVVKDLVVDMEHF
2995|gene|hwa       SLTFRHSCRQAICGSDAMFVNGKQRLCCKTQLSDLEEPVRVEPLPHQDVVKDLVVDMEHF
12880|gene|hbo      SLTFRHSCRQAICGSDALFVNGSQRLGCKTQLSDLEEPVRIEPLPHQEVVKDLVVDMEHF
1989|gene|hla       SLTFRHSCRQAVCGSDAMFVNGGQKLACKTQIADLEQPIRVEPLPHAEVEKDLVVDLEHF
                     *. *. * .                  . ::  .: *   *  .*  :    .*   :*

10930|hp|hma        EDDAPYVTAIAD-----------------------------------------------F
2833|gene|hut       YEQMDAVEPYFEPDELPEDELEEQRQTRENREKIKLSTRCIQCGACASSCNVAAGDNKYL
1308|gene|nrc1      YDQMESVDPFFDPDDLPDGELEEQRQSRQNRENIKLSTRCIWCGACMSSCNIAAGDNKYL
1705|gene|hhi       YDQMEAVEPYFDADETPDDKLEEQRQTRENREKVKMSTRCIWCGACMSSCNIAAGDNEYL
4266|gene|nph       YDQMESVEPYFQTNELPDGDLEEQRQTRENREKVKMSTRCIWCSACMSSCNIAAGDNEYL
2995|gene|hwa       YDQMESVEPYFQTDDLPEGELEEQRQSRQNREKVKMSTRCIWCGACMSSCNVAAGNNDYL
12880|gene|hbo      YDQMESVEPYFQTNDLPDGELEEQRQTRENREKIKMSTRCIWCGACMSSCNIAAGDNKYL
1989|gene|hla       YDQMEAVEPYFQTNEYPDGELEEQRQTRENREKIKMSTRCIWCSACMSSCNIAAGDNEYL
                     ::   * .  :                                               :

10930|hp|hma        GPVSVTGLVR----DVDPDDV------AIDDVVGI-----------------DVGERVTT
2833|gene|hut       GPAALNKAYRFIMDEREGGERREERLEIVEDEHGVWRCQTQFSCTEVCPKDIPLTEHIQE
1308|gene|nrc1      GPAAINKAYRFYMDDREGSEKRQERLEIIEQEHGVWRCQTQFSCTDVCPKDIPLTEHIQE
1705|gene|hhi       GPAAINKAYRFAMDEREGENRKQERLRIIEQEHGVWRCQTQFSCTEVCPKDIPLTEHIQE
4266|gene|nph       GPAAINKAYRFAMDKREGEEMKQHRLNIIEQEHGVWRCQTQFSCTEVCPKDIPLTEHIQE
2995|gene|hwa       GPAAINKAYRFTMDEREGDEMKQERLEIIERENGVWRCQTQFSCTDVCPKDIPLTEHIQE
12880|gene|hbo      GPAAINKAYRFTMDEREGEDMKQHRMEILEQEHGVWRCQTQFSCTEVCPKDIPLTEHIQE
1989|gene|hla       GPAAINKAYRFAMDEREGEEIKQKRLEIIEQEHGVWRCQTQFSCTEVCPKDIPLTEHIQE
                    **.::.   *    . :  :        ::   *:                  : *.:  

10930|hp|hma        GERAVV---FRPR
2833|gene|hut       LKREAIKEDIKFW
1308|gene|nrc1      LKREAVKENLKFW
1705|gene|hhi       LKREAVKNNLKFW
4266|gene|nph       LKREAVKNNLKFW
2995|gene|hwa       LKREAVKNNLKFW
12880|gene|hbo      LKREAVKNNLKFW
1989|gene|hla       LKREAVKNNLKFW
                     :* .:   :. .