HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0673COG0391arCOG04395Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0673 nrc1 VNG1429 vng1429 no entry
cHOG0673 hmu HMUK2581 Hmuk_2581 LPPG domain protein containing protein( EC:2.7.8.- )
cHOG0673 hma RRNAC0051 LPPG:FO 2-phospho-L-lactate transferase
cHOG0673 hwa HQ3012A LPPG:FO 2-phospho-L-lactate transferase
cHOG0673 hla HLAC2334 Hlac_2334 LPPG domain protein containing protein
cHOG0673 hbo HBOR11120 Hbor_11120 LPPG:FO 2-phospho-L-lactate transferase( EC:2.7.8.- )
cHOG0673 hut HUTA0762 Huta_0762 LPPG domain protein containing protein
cHOG0673 hvo HVO_2479 HVO_2479 CofD LPPG Fo 2-phospho-L-lactate transferase
cHOG0673 nph NP2028A LPPG:FO 2-phospho-L-lactate transferase
cHOG0673 hhi 810 HAH_0810 LPPG:FO 2-phospho-L-lactate transferase
MUSCLE (3.6) multiple sequence alignment


2028|gene|nph       MVTFLAGGTGTPKLRYGAETVFDTADTPVVCNTGDDVELGGLVVCPDVDTVLFAAADRLD
1429|chp|nrc1       MTTFLAGGTGTPKLLAGARRVFDPAETTVVGNTGDDVALGGLLVCPDLDTVLFEGGGVLD
3012|gene|hwa       MVTFLAGGTGTPKLLQGAPAVFDPAATTVIANTGDDVELAGHLVCPDVDTVLFSEGGVLN
762|gene|hut        MITFLAGGTGTPKLLAGADDVFPPSETTVVANTGDDVELGGLLVCPDVDTCLFQAGEILD
2334|gene|hla       MVTFLAGGTGTPKLLDGATRVWHPDEIAVVANTGDDIELGGHLVCPDVDTVLFAGGGVLD
11120|gene|hbo      MVTFLAGGTGTPKLLDGSSEVFGPSETTVVANTGDDVELGGHLVCPDVDTVLFHGGGVLD
10051|gene|hma      MVTFLAGGTGTPKLLAGADDVFSPAATTVVANTGDDIELGGHLVCPDLDTVLFLDGEVLD
810|gene|hhi        MVTFLAGGTGTPKLLAGADDVFWPAATTVVANTGDDIELGGHLVCPDLDTVLFLDGEVLD
                    * ************  *:  *: .   .*: *****: *.* :****:** **  .  *:

2028|gene|nph       RETWWGIDGDTTETHEELRALADAADLDTG-PRYLPDKKQTAGRDIARWRRFSGVAEFME
1429|chp|nrc1       RETWWGIADDGSTTHDYLTDLAAAADIDPDTPRYLPDDAQTAGRDIARWRRFSAASEFMF
3012|gene|hwa       TNRWWGIEDDTTETHTEIAKLANKAGLADD-PRYLSADEQTSGREISRWRRFSGVAEFME
762|gene|hut        TDTWWGIDGDTAETHEYVRTLSERAGLDGG-PRYLPDERQTAGRDLADWRRFSAVGEFMY
2334|gene|hla       RETWWGIADDTTTTHEELRRLATQVGLGTS-PRYLDDKAQTAGREIARWRRFSGVGEFME
11120|gene|hbo      TDRWWGIEDDTTTTDDELHRLAEAAGFDGG-PRYLSDDAQTGGREISRWRRFSGVAEFME
10051|gene|hma      RETWWGIADDTAETHTELTRLADAAGLDGG-PRYLPDDAQTAGRDIARWRRFSGVAEFMH
810|gene|hhi        RETWWGIADDTAETHSELTRLADAAGLDGG-PRYLPDDAQTEGRSIARWRRFSGVAEFMH
                     : **** .* : *   :  *:  ..:  . ****  . ** **.:: *****...*** 

2028|gene|nph       IGDTDRAVHITRTSLLDEGKRLTEATATLADALGVDHPVLPMSDDPVATLIDTDEG-L--
1429|chp|nrc1       IGDRDRAVHTLRAGLLDEGHTLTEVTRRLADAFDLSVDLVPMSNDPVATIVQTPDG-E--
3012|gene|hwa       IGDRDRAVHLLRTSLLDEGKRLTEVIEILADAFEVDINLIPMSDDPVSTLIHTEVGAESE
762|gene|hut        IGDRDRAIHVTRTSLLDERHTLTEATRILGDALGVDREILPMSDDSVASIVHTPDG-P--
2334|gene|hla       IGDRDRAVHLTRTSLLDEGHTLTEAIRTLADAFDLDVDLLPMSDDPVATLIHTEAGET--
11120|gene|hbo      IGDKDRAVHVTRTSLIDEGYTLTEVTRTLADAFDLDIELLPMSDDPVASIVHTEAG-A--
10051|gene|hma      IGDRDRAVHVTRTSLLDEGRSLTAVTRTLADAFGLERTLLPMSDDPVASIIHTPSG-P--
810|gene|hhi        IGDRDRAVHVTRTSLLDEGQSLTAVTRTLADAFGLDRTLLPMSDDPVASIIHTPSG-P--
                    *** ***:*  *:.*:**   ** .   *.**: :.  ::***:*.*:::: *  *    

2028|gene|nph       --------------------VHFQEFWVHRRAEPTINGVEFRGADAAEPTPEVREALAD-
1429|chp|nrc1       --------------------QHFQTFWVAEHGDPTVEDVEFRGGERATAAQPAIEAIRDG
3012|gene|hwa       TTEKQTTENESETAETAAEIMHFQEYWVHNRAEPPVLDVEFRGVDAATPTQSVKTALTE-
762|gene|hut        --------------------MHFQEFWVARDGEPTVDSVEFRGAEDAAATDAVLDALSA-
2334|gene|hla       --------------------IHFQEYWVARRADPAVADVEFRGAADAEPTAVVRDALAE-
11120|gene|hbo      --------------------MHFQEYWVHRRAEPAVEDVEFRGADDAEPTDAVLTALSD-
10051|gene|hma      --------------------MHFQEWWVGRNGEPPVEDVEFRGAERASATDAVLTALDD-
810|gene|hhi        --------------------MHFQEWWVGRNGVPPVEDVEFRGAERASATDAVLTALDD-
                                         *** :**   . *.: .*****   * .:  .  *:   

2028|gene|nph       PVVIGPSNPITSIGPMVALDGIRKALAETPVVAVSPFVEDRVFSGPADDLMAADGYAPST
1429|chp|nrc1       PVVVGPSNPVTSIGPMLALDGIADALRDAQVVAVSPFVEDEVFSGPAAKLMAAVGHDPST
3012|gene|hwa       PVVIGPSNPVTSIGPMTAMDKFESALKNTSVVAISPFINDRVFSGPAASLMKAVGFEPST
762|gene|hut        PVVIGPSNPITSIGPMTAIDDIAAALDETPVVAVSPFVEDQVFSGPAAKLMAAEGYDPST
2334|gene|hla       PVVIGPSNPVTSIGPMLAIPGVEAALSATPVVAVSPFIGDEVFSGPAADLMAGVGRDPST
11120|gene|hbo      PVVIGPSNPVTSLGPMLSMDAFRDALDRTPVVAVSPFVEDTVFSGPAADLMAGVGYDPST
10051|gene|hma      TVVIGPSNPVTSLGPMLAIDDIQRALHETTVVAVSPFIEDTVFSGPAADLMAGVGLEPST
810|gene|hhi        TVVIGPSNPVTSLGPMLAIDEFEQALHETTVVAVSPFIEDTVFSGPAADLMAGVGLEPST
                    .**:*****:**:*** ::  .  **  : ***:***: * ****** .** . *  ***

2028|gene|nph       AGVAEAYPFADAFVVDEADETPL-ERPTVRTDTELGSPADGERVCRAVREAFDRLGVEVA
1429|chp|nrc1       AGVADAYDFADAFVLDTADSTDL-DRPVVRTDTSLDTEADAERVARACRDALVAASGEVT
3012|gene|hwa       AGVAEAYPFADAFILDTADQTTL-DRPVVRTDIELDTDTDAKRVLQAVQTAFKKIS----
762|gene|hut        AGVAAAYPFVDGFVLDEADGTDL-DRPTVRTDTTLDTDEDAARVARAVREALEVVA----
2334|gene|hla       AGVADAYPFADAFVLDDDDPTDLPDRHVERTDTRIDDADDAERVARVCDRALAAVEGAEA
11120|gene|hbo      AGVAEAYPFADAFVLDTEDGTAL-DRPVVRTDTKIDGPADAARVARAVESALAEVS----
10051|gene|hma      AGVAEAYPFADSFVLDEEDSTPL-DVPVVRTDTTLNDAADAERVNRAVETALSEVA----
810|gene|hhi        GGVAEAYPFADAFVLDDDDSTLL-DVPVVRTDTTLDDAADAERVNRAVETALSEVA----
                    .*** ** *.*.*::*  * * * :  . ***  :.   *. ** ..   *:        

2028|gene|nph       --------
1429|chp|nrc1       --------
3012|gene|hwa       --------
762|gene|hut        --------
2334|gene|hla       EADAEVAE
11120|gene|hbo      --------
10051|gene|hma      --------
810|gene|hhi        --------