HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0672COG0442KOG4163 KOG2324Prolyl-tRNA synthetaseproline-tRNA synthetase

HOG Organism Gene ID Name Annotation
cHOG0672 nrc1 VNG0403 proS proline-tRNA synthetase
cHOG0672 hmu HMUK3132 Hmuk_3132 prolyl-tRNA synthetase( EC:6.1.1.15 )
cHOG0672 hma RRNAC0166 proS prolyl-tRNA synthetase
cHOG0672 hwa HQ1715A proS prolyl-tRNA synthetase
cHOG0672 hla HLAC0777 Hlac_777 prolyl-tRNA synthetase
cHOG0672 hbo HBOR23500 Hbor_23500 prolyl-tRNA synthetase( EC:6.1.1.15 )
cHOG0672 hut HUTA2695 Huta_2695 prolyl-tRNA synthetase
cHOG0672 hvo HVO_0870 HVO_0870 proS prolyl-tRNA synthetase
cHOG0672 nph NP1796A proS prolyl-tRNA synthetase
cHOG0672 hhi 915 proS prolyl-tRNA synthetase
MUSCLE (3.6) multiple sequence alignment


1796|gene|nph       --MTDQELGITESKEHNPGEWYAEVVQKAGLADYAPMG--GFIVTRPRGYALWERLQDHL
2695|gene|hut       -MSGEQELGITESKEHATGEWYAELVQKAGLADYAPMG--GFIVTRPRGYAIWERLKNHL
10166|gene|hma      -MSGEQELGITESKEHSPGEWYAEVVQKAGLADYAPMG--GFIVTRPRGYAIWERIQNNL
915|gene|hhi        -MSGEQELGITESKEHSPGEWYAEVVQKAGLADYAPMG--GFIVTRPRGYAIWERIQNNL
403|gene|nrc1       ------------------------------------MG--GFIVTRPRGYALWEAIQDNL
1715|gene|hwa       -MSEDQDLGITQSKIHNTGEWYAEVVQKAELANYGPEGMSGFIVTRPRAYGLWERVQSYL
777|gene|hla        MSDDDQELGITESKSHNTGEWYAEVVQKAGLADYGPEGMSGFIVTRPRAYAVWERLQGFL
23500|gene|hbo      -MSDEQELGITESKEYNTGEWYAEVVQKAGLANYGPEGMSGFIVTRPRAYALWERVQGFL
                                                         *  ********.*.:** ::. *

1796|gene|nph       DGWFKETGVQNTYFPMFIPESYLEREKDIVDGFDPEVAWVTHGGHDELEERLAVRPTSES
2695|gene|hut       DGWFKQTGVQNAYFPMFIPESYLEKEKDIVEGFDPEVAWVTKGGYDELEEQLAVRPTSES
10166|gene|hma      DGWFKDTGVQNAYFPLFIPESYLEKEKDVVEGFDPEVAWVTHGGHNELEERLAVRPTSES
915|gene|hhi        DGWFKDTGVQNAYFPLFIPESYLEKEKDVVEGFDPEVAWVTHGGHDELEERLAVRPTSES
403|gene|nrc1       DGWFKDTGVENAYFPMFIPEDYLEREKDIVEGFDPEVAWVTQGGHDDLDQRLAVRPTSES
1715|gene|hwa       DTRFKQTGVQNAYFPLFIPEGYLEREKEIVEGFDPEVAWVEQAGRNELEERLAVRPTSES
777|gene|hla        DAKFKDTGVQNAYFPLFIPESYLEREKDIVEGFDPEVAWVTEAGNKELEERLAVRPTSES
23500|gene|hbo      DARFKDTGVQNAYFPLFIPESYLEREKDIVEGFDPEVAWVTQAGHDELEERLAVRPTSES
                    * .**:***:*:***:****.***.**::*:*********  .* .:*::.*********

1796|gene|nph       IITPFIAEWVRSYRDLPLRVNQWCSVVRWEATETKPFFRTKEFLWQEGHTAHATEESAWD
2695|gene|hut       IITPFLAQWTRSHRDLPIRVNQWCSVVRWEATETKPFFRTKEFLWQEGHTAHHDEEDAVE
10166|gene|hma      IIAPFMAQWTRSHRDLPMRLNQWCSVVRWEATETKPFFRTKEFLWQEGHTAHADEDGAWE
915|gene|hhi        IIAPFMAQWTRSHRDLPLRLNQWCSVVRWEATETKPFFRTKEFLWQEGHTAHADEDGAWE
403|gene|nrc1       IIAPYLSQWVRSHRDLPLRVNQWNSVVRWEATETKPFFRTKEFLWQEGHTAHATDEAAWA
1715|gene|hwa       IIAPYLSQWIRSYRDLPLRVNQWTSVVRWEATETKPFFRTKEFLWQEGHTAHATRADAWA
777|gene|hla        IITPYISQWVRSHRDLPLRVNQWCSVVRWEATETKPFFRTKEFLWQEGHTAHATHEGAWE
23500|gene|hbo      IIAPYMSQWVRSHRDLPLRVNQWASVVRWEATETKPFFRTKEFLWQEGHTAHATAEAAWD
                    **:*::::* **:****:*:*** ****************************     *  

1796|gene|nph       ETMTRLEQYERLYEEVMAIPGMTGRKPEHDKFPGADTTTTIEALMPDGKSVQAGTSHYLG
2695|gene|hut       EMETRLGQYKRLYEDVLAMPVLSGRKPDHDKFPGAHTTTTVEALMPDGKSVQGGTSHYLG
10166|gene|hma      ETMTRLDQYARLYEEVMAMPPLKGRKPPHDKFPGAHTTTTIETLMPDGKTVQAATSHYLG
915|gene|hhi        ETMTRLDQYARLYEEVMAMPPLKGRKPEHDKFPGAHTTTTIETLMPDGKTVQAATSHYLG
403|gene|nrc1       ETTLRLDQYHRLYEDVLGIPVLRGRKPDHDKFPGADTTMSVEALMPDGKSVQGGTSHHLG
1715|gene|hwa       ETMLRLNQYESTYEDLLAIPVLQGAKPEHDKFPGADTTTTVEALMPDGKSVQGATSHYLG
777|gene|hla        ETMTRLDQYASVYEDLLAMPVLKGQKPDHDKFPGAETTTTVEALMPDGKSVQAGTSHHLG
23500|gene|hbo      ETMTRLDQYESVYEDLLAIPVLRGAKPEHDKFPGANTTTTVEALMPDGKSVQGATSHDLG
                    *   ** **   **:::.:* : * ** ******* ** ::*:******:**..*** **

1796|gene|nph       TSFAEAFDIEYTDEDETKQTAHTTSWGLSWRALGALIMTHSDDQGLVIPPALAPTQVVVV
2695|gene|hut       TSFAEAYDVTYVDEDEEVKTAHTTSWGLSWRALGALFMTHSDDQGLVLPPTLAETQVVIV
10166|gene|hma      TSFGEAFDITYADADEEENTAHTTSWGLSWRAMGALIMTHSDDQGLVLPPALAPDQVVVV
915|gene|hhi        TSFGEAFDITYADADEEENTAHTTSWGLSWRAMGALIMTHSDDQGLVLPPALAPDQVVVV
403|gene|nrc1       QSFADAFDITFADEDEAERTAYTTSWGLSWRAIGALVMSHSDDQGLVLPPTVAPKQVVIV
1715|gene|hwa       TEFADAFDITYTDTDETSRVAHTTSWGLSWRALGALIMTHSDNQGLVLPPTVAPEQVVIV
777|gene|hla        QSFAEAFDITFSDEDEEERIAHTTSWGLSWRALGALIMTHSDEQGLVLPPGVAPEQVVVV
23500|gene|hbo      TSFAEAFDLTYTDEDEESQVAHTTSWGLSWRALGALIMTHSDDQGLVLPHTVAPEQVVIV
                     .*.:*:*: : * **  . *:**********:***.*:***:****:*  :*  ***:*

1796|gene|nph       PIWQADTEEAVKEYAADLAAELDEQ-FRVELDDRDERNPGFKFNEHELQGVPLRIEIGPN
2695|gene|hut       PIWDEDSKDDVLAYAEDVEADLEDAGVRVELDDRDHRNPGFKYNEHELNGVPLRIEIGSY
10166|gene|hma      PIWQEDNKDEVIDYAADLAAELDEADVRVELDDREHRNPGFKYNEHELHGVPLRVEIGPH
915|gene|hhi        PIWQEDNKDEVIDYAADLAAELDEAGVRVELDDREHRNPGFKYNEHELHGVPLRIEIGPH
403|gene|nrc1       PIWQEDTKDDVEQYGAEIAAELEAQGVRVHFDDRDGRNPGFKFNEWELNGVPVRFEIGPN
1715|gene|hwa       PIWQTETKERVLEYAEDVANNLDDAGIRVELDDRDDQNPGFKFNEWELKGVPLRAEIGPD
777|gene|hla        PIWQEDTKDEVLEYAEGVADDLDDAGIRVELDDRDGRNPGFKFNEHELNGVPLRIEIGPH
23500|gene|hbo      PIWQADTQEKVLEYAESISEELEDAGIRVELDDRDERNPGFKFNEWELKGVPVRFEIGPN
                    ***: :.:: *  *.  :  :*:   .** :***: .*****:**.**:***:* ***. 

1796|gene|nph       EVEDEAATLVHRPDGESDVAERESITDAVDEALETVYAKLYASAEATLEENIRKAHGRGE
2695|gene|hut       EVADDELTLVHRPDGEEITVERDNVAETVEDHLDTIFAKLYASAEETLEGEIREAESREE
10166|gene|hma      EVEDGEATLVHRPDGETETVDRDGIADTVTDHLDTVHAKLYASAEETLEGEIREAESREE
915|gene|hhi        EVEDGEATLVHRPDGENATVDRESIADTVTDHLDTVHAKLYADAEETLEGEIREAESREE
403|gene|nrc1       EVEDDEVTVVHRPDGESTVEDRAAIADRVHDHLDEVYDKLYDAAADRLAENVREADNRAD
1715|gene|hwa       EATEGTVTLIHRPDGESITAERSEIVETVQEQFDAVYAKLYAAAEETLNSNIRIAETRSE
777|gene|hla        EVEDGELTLVHRPDGESVVEDREGVVATVQDHFDEVYAKLYATAEETLDGAVREADDRAD
23500|gene|hbo      EVDDDVVTVVHRPDGETKEVAREDIAETVREEFDEVYAKLYAAAEENLEENVREADSRAD
                    *. :   *::******     *  :.  * : :: :. ***  *   *   :* *  * :

1796|gene|nph       ILGTLGQHGGYVKTGWCGDEACEAEIKDEIAAEIVMLPL--------------DEDEPPV
2695|gene|hut       ILGTIGQHGGYVKCGWCGDEACEEPIKDAIAAEIVMVPK--------------DRDEEPI
10166|gene|hma      ILGTIGQHGGYVKCGWCGDEDCEEPIKDAIAAEIVMVPL--------------DRDEEPI
915|gene|hhi        ILGTIGQHGGYVKCGWCGDADCEEPIKDAIAAEIVMVPL--------------DRDEEPI
403|gene|nrc1       ILGTIGQHGGYVKAPWCGDQDCEAEIKDQIAAEIVMVPLGEDSAARAASELEGERVPEPD
1715|gene|hwa       LLGTIGQHGGYVKTPWCGDEGCETAIKDEIAAEIVMVPISSDE----------DDEQDTT
777|gene|hla        ILGTLGQHGGYVTAPWCGDEACEEPIKEPMAAEIVMVPF--------------EDDDPLA
23500|gene|hbo      ILGTIGQHGGYVKAPWCGDEDCETEIKDQIAAEIVMVPL--------------NDEEAEV
                    :***:*******.  ****  **  **: :******:*               :      

1796|gene|nph       Y----------------------DTCGVCGDEATETAYFAKSY
2695|gene|hut       H----------------------DECAICGDEAEETAYFAKTY
10166|gene|hma      H----------------------EDCAICGEDAEETAYFAKSY
915|gene|hhi        H----------------------DDCAICGEDAEETAYFAKSY
403|gene|nrc1       HDG--------------------EDCAICGDEATRTAYFAKSY
1715|gene|hwa       DENMGVNNDTTVESNEKSLDLTDSTCVVCDNPAFKTAYFAKSY
777|gene|hla        EADHG------------------ETCAICDDDAERTAYFAKSY
23500|gene|hbo      HDG--------------------EDCAICGDDADETAYFAKSY
                                           . * :*.: *  ******:*