HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0671COG0447arCOG00240Dihydroxynaphthoic acid synthasedihydroxynaphthoic acid synthase

HOG Organism Gene ID Name Annotation
cHOG0671 nrc1 VNG1079 menB dihydroxynaphthoic acid synthase
cHOG0671 hmu HMUK2252 Hmuk_2252 naphthoate synthase( EC:4.1.3.36 )
cHOG0671 hma RRNAC0841 ech1 naphthoate synthase
cHOG0671 hwa HQ1874A menB naphthoate synthase
cHOG0671 hla HLAC2150 Hlac_2150 naphthoate synthase
cHOG0671 hbo HBOR17670 Hbor_17670 1,4-Dihydroxy-2-naphthoate synthase( EC:4.1.3.36 )
cHOG0671 hut HUTA0395 Huta_0395 naphthoate synthase
cHOG0671 hvo HVO_1465 HVO_1465 menB naphthoate synthase
cHOG0671 nph NP2730A menB naphthoate synthase
cHOG0671 hhi 1480 menB naphthoate synthase
MUSCLE (3.6) multiple sequence alignment


1079|gene|nrc1      ------------------------------------MVSETFDDAAWTAIE-EFSFDDIT
1874|gene|hwa       ------------------------------------MVSELFDPAQWDDVEGTEVFDDIT
2150|gene|hla       ------------------------------------MVSDIFDPDAWEPV--TDEFDDIT
17670|gene|hbo      ------------------------------------MVSDIFDSDRWEQVDGAAEFDDIT
2730|gene|nph       ------------------------------------MVSELFDEDRWEPI--TDDFEDIT
395|gene|hut        ------------------------------------MVSELFDPDRWAPIE-SFDFADIT
10841|gene|hma      MWRASLVGSRARHQRVCSAVGTRTRNLFAKAVPSHGMVSELFDPERWTAID-RFDFADIT
1480|gene|hhi       ------------------------------------MVSELFDPERWTAID-RFDFADIT
                                                        ***: **   *  :     * ***

1079|gene|nrc1      YHRGVEVPAVRIAFDRPAVRNAFRPGTVDELYTALDHARKQADIGCVLLTGNGPSPSDGG
1874|gene|hwa       YHRGHEVPVVRIAFDRPEQRNAFRPGTVDELYAALDHARKQADIGCILLTGNGPSEDDGG
2150|gene|hla       YHRGVDVPVVRIAFDRPEVRNAFRPGTVDELYAALDHARKQADVGCVLLTGNGPSEKDGG
17670|gene|hbo      YHRAVDVPAVRIAFDRPEKRNAFRPGTVDELYAALDHARKQADVGCVLLTGNGPSEKDGG
2730|gene|nph       YHRSTETGAVRIAFDRPEVRNAFRPETVDELYTALDHAKRQTDIGCVLLTGNGPSPKDDG
395|gene|hut        YHRARDVGAVRIAFDRPDVRNAFRPETVDELATALDHAKRQTDVGTVLLTGNGPSSKDGG
10841|gene|hma      YHRSTDTGAVRIAFDRPEKRNAFRPETVDELATALDHAKRQTDVGCVLLTGNGPSEKDGG
1480|gene|hhi       YHRSTDTGAVRIAFDRPGKRNAFRPETVDELATALDHAKRQTDVGCVLLTGNGPSEKDGG
                    ***. :. .********  ****** ***** :*****..*:*:* :******** .*.*

1079|gene|nrc1      WAFCAGGDQSVRGDSGYEYHGD-----DEAAADDDP--------AVKRADAGRLHILEVQ
1874|gene|hwa       WAFSAGGDQSVRGESGYEYRDD-----DEPADDEDT--------LVREAKAGRLHILEVQ
2150|gene|hla       WAFCSGGDQSVRGGSGYEYRDD-----DEAGDEDDP--------LVKEARAGRLHVLEVQ
17670|gene|hbo      WAFCAGGDQSVRGGSGYEYRDD-----DEADDADDP--------LVREAKAGRLHILEVQ
2730|gene|nph       WAFCSGGDQRIRGEAGYEYEDT-----PDAEQQDAP----------------RLHILEVQ
395|gene|hut        WAFSAGGDQSIRGDAGYEYADD--GSGDAGGSQEGP----------------RLHILEVQ
10841|gene|hma      WAFCAGGDQSIRGESGYEYSESPRDSDTASGEQSDPRETSDGVEDDAPENVGRLHILEVQ
1480|gene|hhi       WAFCAGGDQSIRGESGYEYSESPRDSDTASGEQSDPRETSDGVEDDAPENVGRLHILEVQ
                    ***.:**** :** :****              . .                ***:****

1079|gene|nrc1      RLIRTMPKPVVAVVPGWAVGGGHSLHVVCDLTLASREHAKFKQTDPDVASFDGGFGSAYL
1874|gene|hwa       RLIRFMPKPVVAVVPGWAVGGGHSLHVICDLTLASKEHAKFLQTDPDVASFDGGFGSAYL
2150|gene|hla       RLIRFMPKPVVAVVPGWAVGGGHSLHVICDLTLASEEHAKFLQTDPDVASFDGGFGSAYL
17670|gene|hbo      RLIRFMPKPVVAVVPGWAVGGGHSLHVVCDLTLASDEHAKFLQTDPDVASFDAGFGSAYL
2730|gene|nph       RLIRHIPKPVIAVVPGWAVGGGHSLHVVCDMTLASEAHAKFLQTDPDVASFDAGFGSAYL
395|gene|hut        RQIRHMPKPVVAVVPGWAVGGGHSLHVICDMTLASEEHAKFLQTDPDVGSFDGGFGSAYL
10841|gene|hma      RQIRHIPKPVVAVVPGWAVGGGHSLHVVCDLTLASEEHAKFLQTDPDVGSFDGGFGSAYL
1480|gene|hhi       RQIRHIPKPVVAVVPGWAVGGGHSLHVVCDLTLASEEHAKFLQTDPDVGSFDGGFGSAYL
                    * ** :****:****************:**:****  **** ******.***.*******

1079|gene|nrc1      AKQVGQKTAREIFFLGKTYDAEAAADMGMVNEAVPHDDLEATALEWADEMTAKSPTAMRM
1874|gene|hwa       AKQIGQKKAREVFFRGKTYSAAEAVEMGMANEAIPHAELEDIAIEWANEMATKSPTAIRM
2150|gene|hla       AKQIGQKKAREVFFRGKTYSAEEAADMGMVNEAIPHEELEEVAIEWADEMTKKSPTAMRM
17670|gene|hbo      AKQVGQKKAREVFFRGKTYSAEEAVDMGMANEAIPHEKLETVALEWADEMTNKSPMAMRM
2730|gene|nph       ARQIGHKKAREVFFLGKTYSADEAVEMGMANEAVPHEDLEDVAHEWAERILSKSPMAIRM
395|gene|hut        ARQVGQKKAREIFFLGKSYDAEEAADMGMVNDVVPHEELEDTALEWAKRIEGKSPTAMRM
10841|gene|hma      ARQVGQKKAREVFFLGKTYDAAEAADMGMVNDVVPHEDLEDTAIEWAERMNEKSPTAMRM
1480|gene|hhi       ARQVGQKKAREVFFLGKTYDAAEAADMGMVNDVVPHEDLEDTAIEWAERMNEKSPTAMRM
                    *.*:*:*.***:** **:*.*  *.:***.*:.:** .**  * ***. :  *** *:**

1079|gene|nrc1      LKYAFNMTDDGMVGQQTFAGEATRLAYMTDEAQEGRDAFLDGRDPDFDEYPWHY
1874|gene|hwa       LKYAFNLADDGLVGQQVFAGEATRLAYMTDEAREGRNAFLEGRDPDFSSYPWHY
2150|gene|hla       LKYAFNMTDDGMVGQQVFAGEATRLAYMTDEAQEGRDAFLEKRDPEFRDYPWHY
17670|gene|hbo      LKYAFNMTDDGLVGQQVFAGEATRLGYMTDEAQEGRDAFLEKRDPNFSDYPWHY
2730|gene|nph       LKYAFNMDSDGLVGQQVFAGEATRLGYMTTEAQEGRDAFNENRKPDFEQFDWHY
395|gene|hut        LKYAFNLPEDGMVGQQVFSGEATRLAYMTDEAQEGRDAFNEGREPDFNEYPWHY
10841|gene|hma      LKYAFNLDSDGMVGQQVFAGEATRLAYMTDEAQEGRDAFNEGRDPDFDDVPWHY
1480|gene|hhi       LKYAFNLDSDGMVGQQVFAGEATRLAYMTDEAQEGRDAFNEGRDPDFDDVPWHY
                    ******: .**:****.*:******.*** **.***:** : *.*:* .  ***