HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0067COG0719arCOG01715ABC-type transport system involved in Fe-S cluster assembly permease componentABC transporter.membrane component

HOG Organism Gene ID Name Annotation
cHOG0067 nrc1 VNG0525 yurZ ABC transporter.membrane component
cHOG0067 hmu HMUK2919 Hmuk_2919 FeS assembly protein SufB
cHOG0067 hmu HMUK3231b Hmuk_3231 FeS assembly protein SufB
cHOG0067 hma RRNAC1829 hypothetical protein
cHOG0067 hwa HQ1707A sufB ABC-type transport system involved in Fe-S cluster assembly, permease protein I
cHOG0067 hla HLAC0175 Hlac_175 FeS assembly protein SufB
cHOG0067 hbo HBOR23590 Hbor_23590 Iron-regulated ABC transporter membrane component SufB
cHOG0067 hut HUTA0377 Huta_0377 FeS assembly protein SufB
cHOG0067 hvo HVO_0860 HVO_0860 sufB FeS assembly protein SufB
cHOG0067 nph NP1502A abc31p_1 Fe-S cluster assembly protein ABC transporter permease
cHOG0067 nph NP3016A sufB_3 Fe-S cluster assembly protein ABC transporter permease
cHOG0067 hhi 2354 sufB FeS assembly protein SufB
MUSCLE (3.6) multiple sequence alignment


525|chp|nrc1        MSSED--IQDTDTEARFEFKKEENSAFESEKGLTEETIRVISEDKDEPDWMLDRRLRALE
377|gene|hut        MSSDNN-LESTDTEARFEFKKEQSSAFEAEVGLNEETVRKISEDKDEPEWMLDRRLRALE
11829|hp|hma        MSSDQDHLKETDTEKRFEFKKEEKSAFEAEKGLTEETIRVISEDKDEPEWMLERRLRALE
2354|gene|hhi       MSSDQDHLKETDTEKRFEFKKEEKSAFEAEKGLTEETIRVISEDKDEPEWMLERRLRALE
1502|gene|nph       MSSEEDHIKETDTEARFEFKKEESSAFKTEKGLTEETIRVISEDKDEPEWMLERRLRALE
3016|gene|nph       MSSEEDHLKDTDTEARFEFKKEESSAFKTEKGLTEETIRVISEDKDEPEWMLERRLRALE
1707|gene|hwa       MSSEQDHLQDTDTEARFDFKKEESSAFKTEKGLTEETIRLISEDKDEPEWMLQRRLRALE
23590|gene|hbo      MSSDQDHLKETDTEARFEFKKEQKSSFQADKGLTEETIRVISEDKDEPEWMLKRRLRALK
175|gene|hla        MSSQQDELKETDTEARFEFKKEEKSAFQTEKGLTEETVRVISEDKDEPEWMLERRLRALE
                    ***::  ::.**** **:****:.*:*::: **.***:* ********:***.******:

525|chp|nrc1        QYTKMPMPTDWPGQPDLTELDIEEIVPYIRPDVDKRSGADEWEDLPDEIQDTFEQLGIPE
377|gene|hut        HYQQMPMPSDWPGQPDLSEVNVEDIIPYIRPDIEARGGAEEWDDLPDEIQDTFDKLGIPE
11829|hp|hma        QFHEMPMPDGWPGAPDLSEVDVDEIVPYIRPDIETRGGVDDWNDLPEEIQDTFDKLGIPE
2354|gene|hhi       QYQEMPMPDGWPGAPDLSEVDVDEIVPYIRPDIETRGGVDDWNDLPEEIQDTFDKLGIPE
1502|gene|nph       QFQQMPMPTDWPGQPDLSDVDIDEIVPYIRPDIEARGGAEEWEDLPEEIQDTFDKLGIPE
3016|gene|nph       QFQQMPMPTDWPGQPDLSEVDIDEIVPYIRPDIEARGGAEEWEDLPEEIQDTFDKLGIPE
1707|gene|hwa       QFNAMPMPTSWPEAPDLSEVDVEEIVPYIRPDVDVRAGVDDWTELPDDIKDTFDKLGIPE
23590|gene|hbo      QFQKMPMPTDWPGQPDLSEVDVDEIVPYIRPDVETRGGVDDWTDLPDDIKDTFDKLGIPE
175|gene|hla        QFQEMPMPTDWPGQPDLSEVDIDEIIPYIRPDVDVRAGVDDWTELPDEIKDTFDKLGIPE
                    ::  **** .**  ***:::::::*:******:: *.*.::* :**::*:***::*****

525|chp|nrc1        AERNALSGVGAQYESEVVYQNMQERWEEKGVVFCNMDEAVQEYPELVKEHFMTSCVPPSD
377|gene|hut        AEQQALSGVGAQYESEIVYQNMQEQWEEKGVVFMDMDKAVQEHPELVREYFMTKSVPPSD
11829|hp|hma        AEKNALSGVGAQYESEIVYQNMQERWEDKGVIFCDMDKAVQEHEDILKEYFMTKAVPPSD
2354|gene|hhi       AEKNALSGVGAQYESEIVYQNMQERWEDKGVIFCDMDKAVQEHEDILKEYFMTKAVPPSD
1502|gene|nph       AEKNALSGVGAQYESEIVYQNMQEQWEEKGVIFMDMDKAVQEHPELVREYFMTKCVPPSD
3016|gene|nph       AEKNALSGVGAQYESEVVYQNMQERWEEKGVIFCNMDKAVQEHPELVREYFMTKCVPPSD
1707|gene|hwa       AEKNALSGVGAQYESEVVYQNMQEQWEEKGVIFCDMDEAVREHPEKLKEHFMTKAVPPSD
23590|gene|hbo      AEKNALSGVGAQYESEVVYQNMQERWEEKGVIFCNMDKAVQEHEELVKDYFMTKCVPPSD
175|gene|hla        AEKNALSGVGAQYESEVVYQNMQEQWEEKGVIFCNMDEAVREHEEIVREHFMTKCVPPSD
                    **.:************:*******.**:***:* :**:**.*: : :.::***..*****

525|chp|nrc1        NKFAALHGAVWSGGSFVYVPEDVTVNMPVQAYFRMNSEGMGQFEHTLIIAEEGSEVHYIE
377|gene|hut        NKFAALHGAVWSGGSFVYIPEGVTVQMPIQAYFRMNSEGMGQFEHTLIIAEENSEVHYIE
11829|hp|hma        NKFAALHGAIWSGGSFVYVPEDTTVDMPVQAYFRMNSDGMGQFEHTLIIAEENSEVHYIE
2354|gene|hhi       NKFAALHGAIWSGGSFVYVPEDTTVDMPVQAYFRMNSDGMGQFEHTLIIAEENSEVHYIE
1502|gene|nph       NKFAALHGAIWSGGSFVYVPEGVTVEMPIQAYFRMNSENMGQFEHTLIIAEENSEVHYIE
3016|gene|nph       NKFAALHGAIWSGGSFVYIPEGVTVEMPVQAYFRMNSEGMGQFEHTLIIAEENSEVHYIE
1707|gene|hwa       NKFAALHGAVWSGGSFVYVPEDVTVEMPVQAYFRMNSEGMGQFEHTLIIAEDGAEVHYIE
23590|gene|hbo      NKFAALHGAIWSGGSFVYVPEDTTVDMPVQAYFRMNSEGMGQFEHTLIIAEEGSEVHYIE
175|gene|hla        NKFAALHGAIWSGGSFVYVPENTTVDMPIQAYFRMNSKGMGQFEHTLIIAEEGSEVHYIE
                    *********:********:**..**:**:********..************:.:******

525|chp|nrc1        GCSAPKYGSHNLHSGGVEVFVGEDAHVQYSTVQNWSKNTFNLNTKRAVVEGNGTMEWVSG
377|gene|hut        GCSAPQYARHNLHSGGVEVFVKEGAHVQYSTVQNWSKNTYNLNTKRAIVEADGTMEWISG
11829|hp|hma        GCSAPKYSEFNLHSGGVEVFVKENAHVQYSTVQNWSKNTYNLNTKRAICEADGTMEWVSG
2354|gene|hhi       GCSAPKYSEFNLHSGGVEVFVKENAHVQYSTVQNWSKNTYNLNTKRAICEADGTMEWVSG
1502|gene|nph       GCSAPKYSAFNLHSGGVEVFVKEGAHVQYSTVQNWSKNTYNLNTKRAIVEKDGTMEWVSG
3016|gene|nph       GCSAPKYSAFNLHSGGVEVFVKEGAHVQYSTVQNWSKNTYNLNTKRAIAERDATMEWVSG
1707|gene|hwa       GCSAPKYSAFNLHAGGVEVFVGEDAHVQYSTVQNWSKNTYNLNTKRAIVESEGRMEWISG
23590|gene|hbo      GCSAPKYSAFNLHSGGVEVFVGEDAHVQYSTVQNWSKNTYNLNTKRAIVEKNGRMEWISG
175|gene|hla        GCSAPKYSAFNLHSGGVEVFVGEDAHVQYSTVQNWSKNTYNLNTKRAIAEKGGRMEWISG
                    *****:*. .***:******* *.***************:*******: *  . ***:**

525|chp|nrc1        SMGSKATMLYPSTILKGRGATDNHITIAFAGDGQDIDTGAKVYHNAPDTSSTIESKSIAK
377|gene|hut        SMGSKATMLYPATILKGPGATDNHITIAFAGEGQNIDTGAKVYHNAPDTKSTIESKSISK
11829|hp|hma        SMGSKATMLYPSTVLKGPGATDNHITIAFAGEGQDIDTGAKVYHNAPETKSTIESKSISK
2354|gene|hhi       SMGSKATMLYPSTVLKGPGATDNHITIAFAGEGQDIDTGAKVYHNAPDTKSTIESKSISK
1502|gene|nph       SMGSKATMLYPCTILKGPGATDNHITIAFAGEGQDIDTGAKVYHNAPNTKSTIESKSISK
3016|gene|nph       SMGSKATMLYPSTILKGPGATDNHITIAFAGEGQNIDTGAKVYHNAPNTKSTVESKSVAK
1707|gene|hwa       SMGSKATMLYPSSVLKGRGASDNHITIAFAGDGQDIDTGAKVYHNAPETKSTIESKSISK
23590|gene|hbo      SMGSKATMLYPCSILKGRGASDNHITIAFAGEGQNIDTGAKVYHNAPNTKSTIESKSISK
175|gene|hla        SMGSKATMLYPSTILKGRGASDNHITIAFAGEGQDIDTGAKVYHNAPNTKSTVESKSIAK
                    ***********.::*** **:**********:**:************:*.**:****::*

525|chp|nrc1        DGGRTNYRGLVHIADGAEDSKTNVECDALMFDNDSTSDTMPYMEINESKVDVAHEATVGK
377|gene|hut        DGGRTNYRGLVHISDGAENSSTNVECDALMFDNDSTSDTMPYMEIQESQVDVAHEATVGK
11829|hp|hma        DGGRTNYRGLVHIADGAEDSSTSVECDALMFDNESTSDTMPYMEIQESKVDVAHEATVGK
2354|gene|hhi       DGGRTNYRGLVHIADGAEDSSTSVECDALMFDNESTSDTMPYMEIQESKVDVAHEATVGK
1502|gene|nph       DGGRTNYRGLVHIADGAEGSSTAVECDALMFDNESTSDTMPYMEIEESKVDVAHEATVGK
3016|gene|nph       DGGRTNYRGLVHIADGAENSSTAVECDALMFDNESTSDTMPYMEIEESKVDVAHEATVGK
1707|gene|hwa       DGGRTNYRGLVHIADGAENSSTAVECDALMFDNESTSDTMPYMEINESSVDVAHEATVGK
23590|gene|hbo      DGGRTNYRGLVHISEGAENSSTAVECDALMFDNESTSDTMPYMEINESTVDVAHEATVGK
175|gene|hla        DGGRTNYRGLVHIADGAENSSTAVECDALMFDNKSTSDTMPYMEINESKVDVAHEATVGK
                    *************::***.*.* **********.***********:** ***********

525|chp|nrc1        IGDEDVFYLQSRGLDDDDAKQMIVSGFIEPITEELPIEYAVELNRLIELEMEGSLG
377|gene|hut        IGDEDVFYLQSRGLDDDDAKQMIVAGFIEPITEELPIEYAVELNRLIELEMEGSLG
11829|hp|hma        IGDEDVFYLQSRGLDDDDAKQMIVAGFIEPITEELPIEYAVELNRLIELEMEGSLG
2354|gene|hhi       IGDEDVFYLQSRGLDDDDAKQMIVAGFIEPITEELPIEYAVELNRLIELEMEGSLG
1502|gene|nph       IGDEDVFYLQSRGLDDDDAKQMIVSGFIEPITEELPIEYAVELNRLIELEMEGSLG
3016|gene|nph       IGDEDVFYLQSRGLDDDDAKQMIVSGFIEPITEELPIEYAVELNRLIELEMEGSLG
1707|gene|hwa       IGDEDVFYLQSRGLDDDDAKQMIVSGFIEPITEELPIEYAVELNRLVELEMEGSLG
23590|gene|hbo      IGDEDIFYLQSRGLDDDDAKQMIVSGFIEPITEELPIEYAVELNRLVELEMEGSLG
175|gene|hla        IGDEDIFYLQSRGLDDDDAKQMIVSGFIEPITEELPIEYAVELNRLVELEMEGSLG
                    *****:******************:*********************:*********