HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0668arCOG06373hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0668 nrc1 VNG1820 vng1820 no entry
tucHOG0668 hmu HMUK1403 Hmuk_1403 conserved hypothetical protein
tucHOG0668 hma RRNAC3481 hypothetical protein
tucHOG0668 hwa HQ3025A hypothetical protein
tucHOG0668 hla HLAC1814 Hlac_1814 hypothetical protein
tucHOG0668 hbo HBOR09330 Hbor_09330 hypothetical protein
tucHOG0668 hut HUTA0422 Huta_0422 conserved hypothetical protein
tucHOG0668 hvo HVO_2642 HVO_2642 conserved hypothetical protein
tucHOG0668 nph NP4818A hypothetical protein
tucHOG0668 hhi 702 HAH_0702 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4818|hp|nph       ---MSD---------GYRHDPDAFDEEGDRIVESDIEESRGHGGSGGDDVSGEHPDAVER
1820|hp|nrc1      --------------MVQTHEPQ---------------EAAGTDDMSK-------------
1814|hp|hla       MSSEADGDARESTDGGYVHVPS---------------EGGGSDGADPAVSVSEPEADG--
3025|hp|hwa       -----------------MNTDT---------------EEQTQSDVG--------------
9330|hp|hbo       MNSEDDETS------GYVHRPG---------------SGAGHKSTRDEPEPAG-------
422|chp|hut       ----------------MVDSPE---------------RTPPETDSS--------------
13481|hp|hma      ---MADDES------GYVHRPD---------------TEPQATDTSRAESETGTEAVDGP
702|hp|hhi        ---MADDES------GYVHRPD---------------TEPQSANAPSADSETGTEAADGP
                                                             .                

4818|hp|nph       EFDWRGWTLVAAIFVAFLVVPTIIYLYPR---FPTLFGLSFLDAYLVLPMVPALVLGVLA
1820|hp|nrc1      ---RSQWLLVAALAVCGLAAPAFIYWAGA-----GSFGLGFRDTYLTIPMIPAVLLGVVG
1814|hp|hla       -FGRKGWALTAVLFTCVLVIPGIIYVYPY---AAGALGFSFFATYLALPLIPAVLLGAVA
3025|hp|hwa       -FGIHGWTLVGSLLLCLIIIPGIIYIQPS---ILAAVGIPYLVSLLILPLVPAAALGLIA
9330|hp|hbo       -FGTKGWGLVAVLVLCTLVIPGVIYLDPS---VFASVGIPYNIALLVLPLLPAGVLGLTA
422|chp|hut       -FGS--WLVLGALAIALVVIPWSLIVLPSARGLIGLVGFSLRDAYLVVPLVPAVGLGLLG
13481|hp|hma      EFGTSGWILVGMIGVAFLLVPGAILLLPAAQGVISSFGLTLRDAYLTLPLVPAFALGALA
702|hp|hhi        EFGTSGWILVGMIGVAFLFVPGAILLLPSAQGVISSFGLTLRDAYLTLPLVPAFVLGALA
                        * : . :  . :  *  :            .*:    : * :*::**  **  .

4818|hp|nph       VWATTRP--------
1820|hp|nrc1      VWTAVRG--------
1814|hp|hla       VWSMTAATRDQ----
3025|hp|hwa       VWSMTAATNET---D
9330|hp|hbo       VWSMTGATNGTPDED
422|chp|hut       VWTALRSRRSQ----
13481|hp|hma      VWSAVRSQSK-----
702|hp|hhi        VWSAVRSQSK-----
                  **: