HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0667arCOG04777hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0667 nrc1 VNG1895 vng1895 no entry
tucHOG0667 hmu HMUK1656 Hmuk_1656 conserved hypothetical protein
tucHOG0667 hma RRNAC3398 hypothetical protein
tucHOG0667 hwa HQ3069A hypothetical protein
tucHOG0667 hla HLAC1978 Hlac_1978 hypothetical protein
tucHOG0667 hbo HBOR07990 Hbor_07990 hypothetical protein
tucHOG0667 hut HUTA1376 Huta_1376 conserved hypothetical protein
tucHOG0667 hvo HVO_2368 HVO_2368 conserved hypothetical protein
tucHOG0667 nph NP3214A hypothetical protein
tucHOG0667 hhi 627 HAH_0627 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1376|chp|hut      MRLIRGRAGGTALTGTLYEPGEESPSYEGAPDADAPFVWVCDAFYAVESGGTVQHVDGKD
3214|hp|nph       MLQVRGSAHGTALTGTLYEPDDEPPTFSGAPDDNAPYVWVCDAFYEVESGGRTQTLGDRT
1978|hp|hla       MILVRGSGGGTELTGTVFERGEEPPAYKGAPDEDAPYVWVCDSFYEVESGGSALLVDGEE
3069|hp|hwa       MIFVRGLGGGTGLTGTIFERGEDAPSYKGAPDGDAPYVWVCDEFYEVESGGIETTINDTS
7990|hp|hbo       MLLVRGHGGGTTLTGTIFERGEEAPSYKGAPDEDAPYVWVCDEFYEVESGGSETEIDGRT
1895|hp|nrc1      MLLVRGSAGGTALTGTLYERGETAPSFKGAPDEAAPYVWVCDEFYEVDSGGQVQRVDGED
13398|hp|hma      MLLIRGTAGGTAVTGTLYEPGEEPPEFKGAPDEGTPYVWVCDAFYEVESGGQVQSIGDRE
627|hp|hhi        MLLIRGTAGGTALTGTLYEPGEEPPEFNGAPDEGTPYVWLCDAFYEVESGGQVQSIGDRE
                  *  :** . ** :***::* .: .* :.****  :*:**:** ** *:***    :..  

1376|chp|hut      INVAFESPAPRGFADRDRAIAAAEEHVRTQFGRLGLAESAVEIEHETVVSEHSTADQ---
3214|hp|nph       LQVAFESPMPRGFDDREAALDAAADHVRTQFARLGVDRSTVDIE---VIEAEPQPE----
1978|hp|hla       IRVAFEEPMPRGFDTRDQALSAAKEHVRTQFARIGVDPSGVEVE---VTKEDPA------
3069|hp|hwa       IRIAFESPMPRGFETRDQAVEAAKAHVRTQLARIGVPRSDVRIK---VFRSDPDTGHETE
7990|hp|hbo       INVAFDSPMPRGFDTREQAVEAAKEHVRTQFARVGVAAEDVRIE---VVKSEPGAT----
1895|hp|nrc1      VHVAFESPMPRGFETRDAALEAAREHVRTQFARIGVDPETVDVT---VVQEHEADAEF--
13398|hp|hma      IRIAFESPMPRGFETRDAAIDAAKEHVRTQFARLGVAGETVDVT---VQQAETA------
627|hp|hhi        IRIAFESPMPRGFETRDAAIDAAKEHVRTQFARLGVAGETVDVT---VQQAETA------
                  :.:**:.* ****  *: *: **  *****:.*:*:  . * :    *            

1376|chp|hut      ----
3214|hp|nph       ----
1978|hp|hla       ----
3069|hp|hwa       LERT
7990|hp|hbo       ----
1895|hp|nrc1      ----
13398|hp|hma      ----
627|hp|hhi        ----