HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0665COG2324arCOG02835Predicted membrane proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0665 nrc1 VNG1681 vng1681 no entry
cHOG0665 hmu HMUK1362 Hmuk_1362 carotene biosynthesis associated membrane protein
cHOG0665 hma RRNAC0318 putative carotenoid biosynthesis protein
cHOG0665 hwa HQ2861A carotenoid biosynthesis protein
cHOG0665 hla HLAC1899 Hlac_1899 carotene biosynthesis associated membrane protein
cHOG0665 hbo HBOR10670 Hbor_10670 carotene biosynthesis associated membrane protein
cHOG0665 hut HUTA2375 Huta_2375 carotene biosynthesis associated membrane protein
cHOG0665 hvo HVO_2526 HVO_2526 putative carotenoid biosynthesis protein
cHOG0665 nph NP4768A carotenoid biosynthesis protein
cHOG0665 hhi 1056 HAH_1056 putative carotenoid biosynthesis protein
MUSCLE (3.6) multiple sequence alignment


2375|gene|hut       -------------------MVEFDRRRLEARLDRYVAENRFAIAVLFPAIGAVMLVASAE
10318|gene|hma      -------MGSGEDRTLAGWTLPETKTDATAQFDQFVTENRFTIAVVFPLVGAVTLLASAE
1056|gene|hhi       -------MGSGEDRTIAGWTLPETRTDATAQFDQFVTENRFTIAVVFPLVGAVTLLASAE
1681|chp|nrc1       ---------------------MADRARVEARLHELVAAYRFEIAVVFPVVGAVTLLASAW
4768|gene|nph       ---------------MRSFELP-ARPHVERRLDELVDENRFTIAVVFPAVGAITLLGSAE
1899|gene|hla       MSDPAESAATSGRLGALRARLPDTRREAERLLDRIVRENRFTIAVLFPLVGAIALVGSAE
2861|gene|hwa       ----------MGERSQLLDQIPRSRLDWEARLDRLVRENRFTISVFFPLNGIVLLLASAE
10670|gene|hbo      ---------MVEADVALANRLPTTREEWEYRLDRLVRENRFTISVFFPLNGIVLLLASAE
                                            .      :   *   ** *:*.**  * : *:.** 

2375|gene|hut       GWFPG----ILEFNPYLVLFGTAVMRLPLIAGVAPLIDRRAALAIVGLTLYTYGIEFLGV
10318|gene|hma      GLLPD----PLAFNPYFVLFGTFVMRLPLVAGVFPLVDRRAGLALVALTLYSYGIELVGV
1056|gene|hhi       GLLPD----PLAFNPYFVLFGTFVMRLPLVAGVFPLVDRRAGLALVALTLYSYGIELVGV
1681|chp|nrc1       GWLPP----ALSFNPYFILFGTVVMRLPLVAGLAPLVDRRAAVAVAVLTAYAFGIELLGV
4768|gene|nph       GVLPE----PLSFNPYFLLFGVAVMRLPLIAGIAPLLTKRAAAGLLVLCGYTYAIEFTGV
1899|gene|hla       GWVPE----PLAFNPWFVLFGVLVMRSPLVVGVLPALDRRAVGWLGVLVAYTYAIELFGV
2861|gene|hwa       GWLPE----PLAFNGLLILFGTIVMRSPLLTAALPLTDRRAAASVVALTAYAYAIEYAGV
10670|gene|hbo      GWLSGTVLAPLAFNGLFILFGTFVMRSPLLVGVLPHTTRRGATGVGLLTLYAYLIEYTGV
                    * ..      * **  ::***. *** **:..  *   .*.   :  *  *:: **  **

2375|gene|hut       LTGLPYGDFEYVIDLGPMLLDAVPAALPIFFFPLVLNAYLLCLLLLGDRAALTRIRLPAV
10318|gene|hma      RTGWPYGEFIYGVDLGPMLLGEVPFGLPVFFFPLVLNAYLLVLLLLGNRAASTAVRLLAT
1056|gene|hhi       RTGWPYGEFTYGVDLGPMLLGEVPFGLPVFFFPLVLNAYLLVLLLLGNRAASTAVRLLAT
1681|chp|nrc1       TAGWPYGEFAYRIELGPMLAGKVPLGLPVFFFPLVVNSYLLVVLLLGPRARNRLLRLAAV
4768|gene|nph       LTGYPYGHFEYGVDLGPMLAGHVPAALPLFFLPLVVNAYLLCLLLLGSLARRAAVRIPIV
1899|gene|hla       ATGWPYGTFEYTVSLGPMLGG-VPLALPVFFIPLVVNAYLLCLLLLGPRASNGWLRLATV
2861|gene|hwa       HTGFPYGEFFYGVDLGPIIAG-IPLGLPVFFVPLVMNAYLLCILLLGSRAEHTPTRLLTV
10670|gene|hbo      HTGFPYGQFAYGVALGPTVGG-IPLGLPVFFVPLVMNAYLLCLLLLGDRAEHTVIRLCTV
                     :* *** * * : *** : . :* .**:**.***:*:*** :****  *     *:  .

2375|gene|hut       IATVLAMDLVLDPGAVGLGFWEYAPPLTGDGAWASATAIHFYGVPLSNYLGWILSASVAV
10318|gene|hma      LATVMLVDLVLDPGAVAIGFWIYEMP-------------QFYGVPWQNYAGWLLSGSVAV
1056|gene|hhi       LATVMLVDLVLDPGAVAIGFWTYEMP-------------QFYGVPWQNYTGWLLSGSVAV
1681|chp|nrc1       AATVVWMDVVLDPAAVGLGFWRYFAGG------------PYYGVPLSNYAGWVLSAVVSV
4768|gene|nph       VAAVVGMDLVLDPAAVAVGFWAYDAGG------------LYYQVPWTNYAGWVLSATVSV
1899|gene|hla       IAAVVAMDVVLDPGAVALGFWSF-GGG------------AFFGVPLSNYAGWVLSATVAV
2861|gene|hwa       IITVLLMDIILDPGAVALGFWVYPDGG------------IFYDVPVSNYVGWVLSATIAV
10670|gene|hbo      IIAVLAMDVVLDPGAVALGFWAYTPPG------------AFYGVPLSNYAGWVLSATVAV
                      :*: :*::***.**.:*** :                 :: **  ** **:**. ::*

2375|gene|hut       LAFDLGFERAGLLDRLDRTGFMLDDLVSFVILWGAINAWYGNWLAVGVAGLFGVGLLATD
10318|gene|hma      LLFDFGFDRAGLRRRLRDCPFMLDDLVSFVLLWGGINLFYANWVPVGLAALLGAGLLWTD
1056|gene|hhi       LLFDLGFDRAGLRQRLRDCPFMLDDLVSFVLLWGGINLFYANWVPVGLAALLGAGLLWTD
1681|chp|nrc1       SLLDWGFSRAGIQARVADCEYLLDDLVSFVILWGTVNLAFGNLLPAAAAAALGVGLLQTD
4768|gene|nph       VVLDRAFDWNGLLARVESCRFMLDDLVSFVILWGVVNAYFGNWLPALLAVGYGYGLWRTD
1899|gene|hla       VTLDRAFELGALGDRLRDCEFMLDDMVSFVILWGGINLWYGNLLPAAVAVAFGVGLVRAD
2861|gene|hwa       LALDFGYDRHALLQRVNECAFMLDDLVSFIILWGGINAWFGNYIPTVFAIIFAIGLLRAE
10670|gene|hbo      ILLDWGYDQHILLTRLSECEFMLDDLVSFVILWGGLNAWFGNWLPVAVAALFGLGLLKTE
                      :* .:.   :  *:    ::***:***::*** :*  :.* :..  *   . **  ::

2375|gene|hut       RFDFEVR----ETVPLVDLRQ
10318|gene|hma      RFDFDLS----ETRLGRAVWR
1056|gene|hhi       RFDFDLS----ETRLGRAVWR
1681|chp|nrc1       RFDFAVL-----RDRGPGTRQ
4768|gene|nph       RFDFPER--------------
1899|gene|hla       RFDATLF----------TQWR
2861|gene|hwa       RFDTDLL------------SP
10670|gene|hbo      RFDSRVFRFSQRKRSGKNSSE
                    ***