HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0664COG0023KOG1770 KOG3239arCOG04223Translation initiation factor 1 (eIF-1/SUI1) and related proteinshypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0664 nrc1 VNG2584 vng2584 no entry
cHOG0664 hmu HMUK0627 Hmuk_0627 translation initiation factor SUI1
cHOG0664 hma RRNAC2445 sui1 translation initiation factor Sui1
cHOG0664 hwa HQ3162A tif1 translation initiation factor Sui1
cHOG0664 hla HLAC2078 Hlac_2078 translation initiation factor SUI1
cHOG0664 hbo HBOR05410 Hbor_05410 translation initiation factor 1 (eIF-1/SUI1)
cHOG0664 hut HUTA2534 Huta_2534 translation initiation factor SUI1
cHOG0664 hvo HVO_1946 HVO_1946 translation initation factor SUI1 putative
cHOG0664 nph NP0388A tif1_1 translation initiation factor Sui1
cHOG0664 hhi 2878 sui1 translation initiation factor Sui1
MUSCLE (3.6) multiple sequence alignment


3162|gene|hwa       MSGNVCSTCGLPNELCVCEDVAKDSQEINIRVDERRYGKEVTIIEGFDPKDVDMDSLSSD
2078|gene|hla       -MSEVCSTCGLPQELCVCEDVAKESQQISIRIDERRYGKEVTVIEGFDPKDVDMSSLSSD
2584|chp|nrc1       -MSEVCSTCGLPEELCVCEDVAKESQQIEIRIDERRYGKEVTVIEGFDPKDVDLDSLSSD
388|gene|nph        -MSEVCSTCGLPEELCVCEDVAKESQEINIRIDERRYGKEVTVIEGFDPQDVDLDSLSSD
12445|gene|hma      -MSEVCSTCGLPEELCVCEDVAKESQEINIRIDERRYGKEVTIIEGFDPKDVDMDSLSSD
2534|gene|hut       -MSEVCSTCGLPEELCVCEDVAKESQEINIRIDERRYGKEVTIIEGFDPKDVDMDSLSSD
2878|gene|hhi       -MSEVCSTCGLPEELCVCEDVAKESQEINIRIDERRYGKEVTIIEGFDPKDVDMDSLSSD
5410|gene|hbo       -MSEVCSTCGLPEELCVCEDVAKESQEITIRIDERRYGKEVTVIEGFDPKDVDMDSLSSD
                      .:********:**********:**:* **:**********:******:***:.*****

3162|gene|hwa       LKSKFACGGTIEDGSIELQGNHTGRVEDFLRDKGFNVA
2078|gene|hla       LKSKFACGGTVEDGAIELQGNHSGRVEDFLRDKGFNVA
2584|chp|nrc1       LKSKFACGGTVEDGEIELQGNHSGRVEDFLRNKGFNVA
388|gene|nph        LKSKFACGGTVEDGSIELQGNHLGRVEDFLREKGFNVA
12445|gene|hma      LKSKFACGGTVEDGQIELQGNHTGRVEDFLRDKGFNVA
2534|gene|hut       LKSKFACGGTVEDGQIELQGNHTGRVEDFLRDKGFNVA
2878|gene|hhi       LKSKFACGGTVEDGQIELQGNHTGRVEDFLRDKGFNVA
5410|gene|hbo       LKSKFACGGTVEDGSIELQGNHTGRVEDFLRNKGFNVA
                    **********:*** ******* ********:******