HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0658COG1745arCOG02254Predicted metal-binding proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0658 nrc1 VNG1086 vng1086 no entry
cHOG0658 hmu HMUK2537 Hmuk_2537 Protein of unknown function UPF0058
cHOG0658 hma RRNAC0835 hypothetical protein
cHOG0658 hwa HQ1870A hypothetical protein
cHOG0658 hla HLAC1490 Hlac_1490 Protein of unknown function UPF0058
cHOG0658 hbo HBOR17600 Hbor_17600 predicted metal-binding protein
cHOG0658 hut HUTA2877 Huta_2877 Protein of unknown function UPF0058
cHOG0658 hvo HVO_1473 HVO_1473 Uncharacterised protein family superfamily
cHOG0658 nph NP2722A hypothetical protein
cHOG0658 hhi 1474 HAH_1474 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1086|chp|nrc1      MHKDELLELHEQMVNIKDQFL-GFDHVDETAFAAYEELDVEPSHVHKSKSEHKHAVFLLG
2722|hp|nph        MHKDELLELHAKMVSIMEHFR-EMDEIDASVFDGYDELDVTPDDVHKSKSEHKHAVFVLG
10835|hp|hma       MHKDELLELHEQMVTIMEYFRDDMDSVDPDLFDAYQELDVRPSDVHKSKSEHKHAVFVLG
1474|hp|hhi        MHKDELLELHEQMVTIMEYFRDDMDSVDPDLFDAYQELDVRPSDVHKSKSEHKHAVFVLG
2877|hp|hut        MHKDELLELHEEMVTIMEYFD-RQESVDSELFEPYKEIDVTPADVHMSKSEHKHAVFVLG
1490|gene|hla      MHKDELLELHEQMVTIMEHFR-NHETVDGSLFDPYDELDVDPSHVHKSKSEHKHAVFVLG
17600|hp|hbo       MHKDELLELHEQMVTIKDYFA-SQEHVNSELFEPYEQLAVDPSHVHKSKSEHKHAVFVLG
1870|hp|hwa        MHKDELLELHEQMLTIKQNFA-GRESVDDDLFETYDNLDVNPSHVHKSKSEHKHAVFVLG
                   ********** :*:.* : *    : ::   *  *.:: * *  ** **********:**

1086|chp|nrc1      NALAAAMSEDEFSSAGRISKRMEELADDASNQL
2722|hp|nph        NALAEVMAEDEFSDAGRIGKRMQELADDAESKL
10835|hp|hma       NSLATAMSEDEFSDAGRVSKRMKELAEDAERKL
1474|hp|hhi        NSLATAMSEDEFSDAGRVSKRMKELAEDAERKL
2877|hp|hut        NALANAMSEDEFSDAGRVGKRMKELAEDAESKL
1490|gene|hla      NALANVMSEDEFSPAGRVGKRMKELADDAESKI
17600|hp|hbo       NALAAAMSEDEFSNAGRVGKRMEELAKDAESKL
1870|hp|hwa        NALATVMSEDEFSNAGRVGKRMKELAEDAEGKL
                   *:** .*:***** ***:.***:***.**. ::