HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0656arCOG04783hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0656 nrc1 VNG1827 vng1827 no entry
tucHOG0656 hmu HMUK1395 Hmuk_1395 conserved hypothetical protein
tucHOG0656 hma RRNAC3473 hypothetical protein
tucHOG0656 hwa HQ3193A hypothetical protein
tucHOG0656 hla HLAC2592 Hlac_2592 CTP/GMP synthase operon protein
tucHOG0656 hbo HBOR09480 Hbor_09480 hypothetical protein
tucHOG0656 hut HUTA0425 Huta_0425 conserved hypothetical protein
tucHOG0656 hvo HVO_2626 HVO_2626 conserved hypothetical protein
tucHOG0656 nph NP1972A CTP/GMP synthase operon protein
tucHOG0656 hhi 696 HAH_0696 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3193|hp|hwa        MNNDESQMFLIAGPDENDLAAELNDCGVDIIEINEIVTYESLEAAGLSTADTLVLTTMDD
9480|hp|hbo        ------MTVLITGPDEDGLGDALTDLGIDLVRLNGVATRDSIVDAGIDSADTLVLTDMDD
1827|hp|nrc1       ------MHALVVGGAGTDIADALEAEGVDVTRLEGVVSGDRLEDAGVADADLLVVADSNE
425|chp|hut        ------MQVIVAGADESEIADPIDAEGHDVTAID-VADGTSLADAGIENTDVYLLTEMAQ
13473|hp|hma       ------MNVVLVGTDPNGLTDALEAEGHTVMVAD-VGNRPGLEEAGIHEADVYLLTEMSQ
696|hp|hhi         --------MVLVGSDPNALTDALEAEGHTVTVAD-VGNRPGLEEAGIHEAEVYLLTEMSQ
2592|gene|hla      --MTDQPIAVVAGPDEHGLGEELEALGVEIRRIEGLVTADALSEVGIAEAAYFVLTDVEE
1972|gene|nph      -----MSEVVIAGPDPEGLGEALEAEGASVSHADGTATRPDLEDAGIVDADVFVVTDAGL
                            ::.*     :   :   *  :   :       :  .*:  :   :::    

3193|hp|hwa        ASAIPVAKEQNPAVRVVAYTSDSLPEFARGQTDLAIDPALLNATVVAEELAGL------
9480|hp|hbo        ASIIPVAREENPEVRIVTYSRDSLPEYARGQTDLAVDPALLTADVVAEELAEQ------
1827|hp|nrc1       ATAVPVAHEHNPDIRTVAYTGDGVPEFIKGVLDLTVDPALLDATAVAEELAA-------
425|chp|hut        ATSIAVAKDHNPDVRVVVYAEGSLPEFATRQADLVIDPALLDPEAVAEELA--------
13473|hp|hma       ATSIAVAKDLNPDLRVVVYAEGSLPDFASRQTDLVVDPDLLGSDAVAEEL---------
696|hp|hhi         ATSIAVAKDLAPDLRVVVYAAGSLPDFASRQTDLVVDPDLLDAEAVAEEL---------
2592|gene|hla      ATGIPIAKELNPDVLAVTYAERSLPEFVAGVADLAIDPALMGPETVAEELVDGADDRAA
1972|gene|nph      ATSVPIAVDSNPDIRIVMYTRDSVPEFVKGQAGHIIDPAILDPETVAEELV--------
                   *: :.:* :  * :  * *:  .:*::     .  :** :: . .*****