HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0655COG0049KOG3291arCOG04254Ribosomal protein S730S ribosomal protein S7P

HOG Organism Gene ID Name Annotation
cHOG0655 nrc1 VNG2657 rps7p 30S ribosomal protein S7P
cHOG0655 hmu HMUK0509 Hmuk_0509 ribosomal protein S7
cHOG0655 hma RRNAC2423 rps7P 30S ribosomal protein S7P
cHOG0655 hwa HQ3390A rps7 30S ribosomal protein S7P
cHOG0655 hla HLAC0100 Hlac_100 ribosomal protein S7
cHOG0655 hbo HBOR28160 Hbor_28160 SSU ribosomal protein S7P
cHOG0655 hut HUTA2384 Huta_2384 ribosomal protein S7
cHOG0655 hvo HVO_0354 HVO_0354 rpsG ribosomal protein S7
cHOG0655 nph NP0124A rps7 30S ribosomal protein S7P
cHOG0655 hhi 2854 rps7P 30S ribosomal protein S7P
MUSCLE (3.6) multiple sequence alignment


2657|gene|nrc1      --MSDEQPAEDET---------------EEAAAESEDTQEVAANAKLFGKWDVAEIHYED
3390|gene|hwa       MSESDTDPDIDDDAHNNGDNDVDVAVDESESAETTTDTDTASANAKLFGEWDVSEIEYED
100|gene|hla        MSGEETEAPSDED-----------VAADEPEPDAPASSEAANENAQLFDVWDVTEIAYED
28160|gene|hbo      --MSDSE---------------------QPEPESPADSEEASANAQLFGVWDIVDIEYAD
124|gene|nph        ---MSSE---------------------APEPDAPASTDDERVSAQLFGEWEIGEIEYDD
2384|gene|hut       ----MSA---------------------ETDAEADAEAETETTGAKLFGSWATDDIEFRD
12423|gene|hma      MSAEDTP---------------------EADADAAEESEPETARAKLFGEWDITDIEYSD
2854|gene|hhi       MSAEDTP---------------------EADADEAAESEPETARAKLFGEWEIADIEYSD
                                                   .    .::     *:**. *   :* : *

2657|gene|nrc1      PSTRRYLAVTPVAHTMGRHAQKQFKKSEISIVERLANRLMKTGANAGKKQQALKIVRDAF
3390|gene|hwa       PSTQRYITVTPIAHTMGRHAAKQFEKSKISVVERLINRLMQTEDNTGHKQKTMNIVEDAF
100|gene|hla        PSTKRYMTVTPIAHTMGRHASKQFKKSEISLVERMINRLMQTDENTGKKQQATRIVRDAF
28160|gene|hbo      PSTQRYINVTPIAHTMGRHASKQFQKSEISIVERLINRLMQSEDNTGHKQKTMKIVKDAF
124|gene|nph        PSTRRYITVTPIAHTMGRHSEKQFKKSEISIVERLINRLMQTDENTGKKQQATKIVREAF
2384|gene|hut       PSTERYITVTPIAHTMGRHAKKQFQKSEISIVERLINRLMQTEENTGKKQQSTRLVREAF
12423|gene|hma      PSTERYITVTPIAHTMGRHADKQFKKSEISIVERLINRLMQTDENTGKKQLATSIVTEAF
2854|gene|hhi       PSTERYITVTPIAHTMGRHADKQFKKSEISIVERLINRLMQTDENTGKKQLATSIVTEAF
                    *** **: ***:*******: ***:**:**:***: ****::  *:*:** :  :* :**

2657|gene|nrc1      DIVHERTDENPIQVLVSAVENAAPREETVRLKYGGISVPQAVDTAPQRRVDQALKFLADG
3390|gene|hwa       DTIHNRTEENPVQVLVRGVENAAPREETVRLKYGGISVPQAVDVAPQRRVDQALKFIADG
100|gene|hla        DIIHERTEENPVQILVTAVENAAPREETVRLKYGGISVPKAVDVAPQRRVDQALLFISDG
28160|gene|hbo      EIVHERTDENPIQVLVTAVENAAPREETVRLKYGGISVPQAVDVAPQRRVDQALKFLAEG
124|gene|nph        DIVAERTDENPVQVLVTAVENAGPREETVRLKYGGISVPKAVDVAPQRRVDLALKFIAEG
2384|gene|hut       EIVHNNTDENPIQVLVRAIENSAPREETVRLKYGGISVPKAVDISPQRRVDQALKFIAEG
12423|gene|hma      ELVHERTDENPIQVLVSAVENSAPREETVRLKYGGISVPKAVDVAPQRRVDQALKFLAEG
2854|gene|hhi       EIVHERTDENPIQVLVSAVENSAPREETVRLKYGGISVPKAVDVAPQRRVDQALKFIAEG
                    : : :.*:***:*:** .:**:.****************:*** :****** ** *:::*

2657|gene|nrc1      AHSASFKTPTDAAEALANQLAGAADYNVQT-YAIGQKKEKERVAAAAR
3390|gene|hwa       TQRGSYKSAQSAADSLAQVIIGAANYDVQS-YAVGQKEESERVAEAAR
100|gene|hla        VANATYKSTTSAAEALANELITAADYDPERSYSISQKEERERVAAAAR
28160|gene|hbo      TASGSYKTTTSAAEALAQQLVGASNYNVET-YAINQKEERERVAEAAR
124|gene|nph        TYNDSFKTTTPVEEALAHQLIGAANYDLQA-YPVSQKEEQERVAAAAR
2384|gene|hut       THNASFKTPTDAEEALAQQLMGAANNDVQT-YAVNQKEEKERVAAAAR
12423|gene|hma      VYGGSFKTTTTAAEALAQQLIGAANDDVQT-YAVNQKEEKERVAAAAR
2854|gene|hhi       VYGGSFKTTTSAAEALAQQLIGAANDDVQA-YAVNQKEEKERVAAAAR
                    .   ::*:.  . ::**: :  *:: : :  *.:.**:* **** ***