HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0653COG1545arCOG01286Predicted nucleic-acid-binding protein containing a Zn-ribbonhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0653 nrc1 VNG0676 acaR1 no entry
cHOG0653 hmu HMUK2808 Hmuk_2808 protein of unknown function DUF35
cHOG0653 hma RRNAC0930 hypothetical protein
cHOG0653 hwa HQ2308A hypothetical protein
cHOG0653 hla HLAC1005 Hlac_1005 protein of unknown function DUF35
cHOG0653 hbo HBOR23840 Hbor_23840 predicted nucleic-acid-binding protein containing a Zn-ribbon
cHOG0653 hut HUTA0598 Huta_0598 protein of unknown function DUF35
cHOG0653 hvo HVO_0834 HVO_0834 Domain of unknown function putative
cHOG0653 nph NP3440A hypothetical protein
cHOG0653 hhi 1563 HAH_1563 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2308|hp|hwa        -MSDVGDAGYDELLEAIDAGDGYYLECENEHGSLPPRRVCPHCGSTDIKEVSLPDTGEVV
598|hp|hut         MSDEVRDDGYDDFMDALEEGEPYYVECANGHASLPPRRLCPECATDDLGEAPLAETGELL
10930|hp|hma       MTESAQDGEYDAWLDSIESGDGYYLECSNGHGWLPPRRVCPRCHDQDLSAVDLPESGEIA
1563|hp|hhi        MTESARDGEYDEWLDSIESDDGYYLECSNGHGWLPPRRVCPRCHDQELSAVDLPESGEIA
3440|hp|nph        -------MNYDEFLDALAAGDERYLESPEGHGWLPPRRVCPESGSTDLSPAALPEEGEIV
23840|hp|hbo       ----MTDGGYDEWLAAIGDGEGYYLACPDGHGSLPPRRTCPHCGAMELEKTPLPESGTVE
676|chp|nrc1       MSDRVRDDGYDDAIDALAADEGYYLACPDGHGSLPPRHACPHCGARELTETALPETGTID
1005|gene|hla      MSAPASNGAYDEWLDALAEGEGYALVCPDGHGSLPPRRVCPECGSATLSEEALAETGTVE
                            **  : ::  .:   : . : *. ****. ** .    :    *.: * : 

2308|hp|hwa        AHTTVHVPTPRFSEDAPYDVVIVDYGQVQLTGQLAG----AD--DDIAHGLDVTVQLGEA
598|hp|hut         TYNVTHVPTPEFADDVPFVLGIAEFGDVRLTGQVRA----DS--EDVEVGDTVSIGTDVS
10930|hp|hma       SHTTITVPTPQFEDDAPYVTAIADFGPVSVTGLVRDV---DP--DDVAIDDVVGIDVGER
1563|hp|hhi        SHTTITVPTPQFEDDAPYVTAIADFGPVSVTGLVRDV---DP--DDVAIGDVVGIDVGER
3440|hp|nph        ALTQVHVPAPDFADDAPYCTAVVDFGPVRVTGVLQGV---EY--EAVAIGDTVTAGVGHS
23840|hp|hbo       TFSEIHVAGPDFASQTPYVTAIASFDAVRLTGVLRGVLDEDG--PDPSVGMSVEVHTAEN
676|chp|nrc1       SCSTLHVATPAFADDAPYVLAVASFGAVRLTGQVRA----EP--GTVEIGDEVAATVGES
1005|gene|hla      TYSVVHVAGPQFADDTPYVNAIADFGPVRLTGVLRGI---DPATDAVEIGDRVAPGVEER
                   : .   *. * * .:.*:   :..:. * :** :               .  *       

2308|hp|hwa        TKTGEPVVTFVPAET-
598|hp|hut         ETDGERYIAFDLE---
10930|hp|hma       VTTGERAVVFRPR---
1563|hp|hhi        VTTGDRAVVFRPR---
3440|hp|nph        ETTDERIVVFEPV---
23840|hp|hbo       PDTGDTMVVFRPR---
676|chp|nrc1       ATTGDRLVVFELR---
1005|gene|hla      VTDGEPLVVFRPADGE
                      .:  :.*