HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0652arCOG06239hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0652 nrc1 VNG0596 vng596 no entry
nucHOG0652 hmu HMUK2324 Hmuk_2324 conserved hypothetical protein
nucHOG0652 hma RRNAC0853 hypothetical protein
nucHOG0652 hwa HQ2496A hypothetical protein
nucHOG0652 hla HLAC1287 Hlac_1287 hypothetical protein
nucHOG0652 hbo HBOR20700 Hbor_20700 hypothetical protein
nucHOG0652 hut HUTA0400 Huta_0400 conserved hypothetical protein
nucHOG0652 hvo HVO_1171 HVO_1171 hypothetical protein
nucHOG0652 nph NP4116A hypothetical protein
nucHOG0652 hhi 1492 HAH_1492 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2496|hp|hwa       -------------MYLSHV-E--PQADGLDSLNEVEFISLAPGTELAYTLGQRHCAGVIT
596|hp|nrc1       ------------------------------------------------------------
4116|hp|nph       MRVGDVAFGVQVVGYETGVGDDEPPALQVAVDGAVSREPLAPGRELEYSLGQRRCAGVVD
400|chp|hut       -------------------------------------MNLDPGETLTYTLENRHCAGTID
20700|hp|hbo      -------------MQFVGY-DTAGPGLFLASDGDVEHVTLDPGTELTYTLGERHCAGVMT
1287|hp|hla       ---------MQVVGYESGE------GFTVASGGAVEFVEATAGTELAFGLGDRRCAGTVH
10853|hp|hma      ------------------------------------------------------------
1492|hp|hhi       ------------MGYHARV-DE-HAALLLAEDGSVTIERLDPGTELSYTLGERHCAGAVD
                                                                              

2496|hp|hwa       DEGHYSCRNTSAPHCREHNSTWVCAKCTGTCLKDEMDCYEPHVIYLAVFAPDIHKVGVTK
596|hp|nrc1       ------------------------------------------------------------
4116|hp|nph       GDDHVACDASAAPYCQAHDSTWVCARCTGTCLKAEMDCHQEHAIYLAAFAPSTFKVGVTR
400|chp|hut       DGTHVRCDATAAPYCPQHTDRWPCARCQGDCNLPLESCREEHAVYLAAFAPETFKVGVTR
20700|hp|hbo      DDEHCACENDAAPYCRDHRSTWVCAKCTGTCLKDVMDCHDSHAIYLAAFAPDVFKVGVTK
1287|hp|hla       NGEHIACDAADTPYCDAHGSVWVCARCTGTCLKDEMDCHEEHAVYLAAFAPDVWKVGVTR
10853|hp|hma      ------------------------------------------------------------
1492|hp|hhi       GDRHFHCDNDPAPYCPEHTDIWPCARCTGDCNKPLETCDEEHAVYLAAFASDTVKVGVTR
                                                                              

2496|hp|hwa       QWRLTQRLVEQGADYGIHLQTVSNGRIAREREAEIATTASITDRIRAVTKHTSLYQDVDE
596|hp|nrc1       ------------------------------------------------------------
4116|hp|nph       RSDPRVRLREQGADRGAIIRRVSNGRIAREIEADIAASEPLSDVVRTAVKVAGLGKPIDE
400|chp|hut       SWRLERRLREQGADRGAHIRTVDNGRIARQIEADIAT--TVGDSVRVDRKVAGLHRSVLL
20700|hp|hbo      EWRLETRLREQGADRGAHIRTVANGRIAREIEAGLAD--EIPDRIRVPTKRDGLHRKVDE
1287|hp|hla       LWRLETRLREQGADRAAHIRTYPDGQIAREVEAELAERDNLVDRVRVPTKLRGFGRSVDA
10853|hp|hma      ------------------------------------------------------------
1492|hp|hhi       FWRLETRLREQGADRAAHLRTVADGRIARQVEADIAV--ELGDRVRVPTKISGFDQSVDT
                                                                              

2496|hp|hwa       SAVATQLADVKAESAIELDIGSQAGINAYIESLPEVDLSVSELMTEAVVDNRDEIKENPD
596|hp|nrc1       ------------------------------------------------------------
4116|hp|nph       TAWKRLLSRF-------------------------------------------------E
400|chp|hut       DEWEELLGAF-------------------------------------------------E
20700|hp|hbo      AAWESLLSEF-------------------------------------------------D
1287|hp|hla       AAWESLLDGF-------------------------------------------------D
10853|hp|hma      ------------------------------------------------------------
1492|hp|hhi       DWWASLCERY-------------------------------------------------D
                                                                              

2496|hp|hwa       PPAIYRLGYDLKLSDRPVSETIATGTVRGIKGRLIILDYAGSTYTVDMRDLVGHTINSGT
596|hp|nrc1       ---------------------MLTGTVRATKGRLLVLDRRETTYGVDMRALVGHEITPGA
4116|hp|nph       VSARHSFDYGLGLDATPVAETLAAGTVRGTKGRILVLDRGDDTFAVDMRALVGYEVRSEP
400|chp|hut       VLERFDFAYGLELNDRPVAETLLSGSVRGTKGRILVIERNGTAYAVDMRDLVGCEITQSE
20700|hp|hbo      VLDRFDFDYGLELDARPVDEVIATGTVRGVQGRLLVLDHAGSTYAVDLRDLVGHEVTAEA
1287|hp|hla       PIERFAFDYGLDLDDRPVAETMAAGTVRGWKGRVLVLDRGGSTYAVDARDLVGYELTEEV
10853|hp|hma      -----------------MAETLATGTVRGTKGRVAVLENNGSVYAVDLRQLVGYELTDGG
1492|hp|hhi       PLATYDFEYDLSLSDRPMAETLATGTVRGTKGRVAVLENNSSVYAVDLRQLVGYELTDGG
                                       : :*:**. :**: :::    .: ** * ***  :    

2496|hp|hwa       TTRNLQASLDAWK-
596|hp|nrc1       DDRDRQASLTAF--
4116|hp|nph       PSRRLQSSLGRFE-
400|chp|hut       TARDLQVSLGSFE-
20700|hp|hbo      TTRDVQSSLGAWG-
1287|hp|hla       PDRELQSSLGAFGG
10853|hp|hma      TDRDLQSSLGAFG-
1492|hp|hhi       TDRNLQSSLGAFR-
                    *  * **  :