HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0651COG2090arCOG04171Uncharacterized protein conserved in archaeahypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0651 nrc1 VNG0396 vng396 no entry
cHOG0651 hmu HMUK3076 Hmuk_3076 Protein of unknown function DUF371
cHOG0651 hma RRNAC1816 hypothetical protein
cHOG0651 hwa HQ1529A hypothetical protein
cHOG0651 hla HLAC0781 Hlac_781 Protein of unknown function DUF371
cHOG0651 hbo HBOR23420 Hbor_23420 uncharacterized conserved protein
cHOG0651 hut HUTA2703 Huta_2703 Protein of unknown function DUF371
cHOG0651 hvo HVO_0879 HVO_0879 Uncharacterized protein conserved in archaea
cHOG0651 nph NP4060A hypothetical protein
cHOG0651 hhi 2342 HAH_2342 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


781|gene|hla      -MSDAESDVGDVVDDPLVEVVRAVGHENITAEHASTVELTTDDWLTPAGDCIVGVEADRT
1529|hp|hwa       MSIESENKNHSTETKEFSEVIHAQGHTNVSARHASTLEVTSDDWLTPAGDCILAIDADRV
396|chp|nrc1      ----------------MDVSVSATGHDNVTARHDSTLELTTDDFLTPAGDCILGIDADCS
4060|hp|nph       ----------------MEKVIRASGHENVSAEHSSTFELTSDDWLTPAGDCILGVEADTV
2703|hp|hut       ----------------MDEVIHATGHEHVTATHESTLELTSDDFLTPAGDCIVGIEADRV
23420|hp|hbo      ---------------MYEEVVRARGHENVSAEHASTFEVTSDDWLTPAGDCILAVEADRT
11816|hp|hma      --------------MTLEEVVRAQGHENVSGEHASTLEVTSDDFLTPAGDCILAIEADRV
2342|hp|hhi       -------------------MVHAQGHENVSGEHASTLEVTSDDFLTPAGDCILAIEADRV
                                      : * ** :::. * **.*:*:**:********:.::**  

781|gene|hla      PRDFSTSFREACQEADATITATFAVGEPGDEAVDVDDPAYVAEIAGRGDPDLTLLDDRSM
1529|hp|hwa       PSDFDTEFIQACQSPNAIITATITVESEAVG-------THTEKITGSGSPQLSFDNNRSH
396|chp|nrc1      PAAFSDAFVAACQDAAATITLVLDTPQH------------RDEITGSGHPDLTFTNDRSM
4060|hp|nph       PADFDDAFVEACQSHEATITATLRVGDE------------TQVIEGHGHPELTFESDRSL
2703|hp|hut       PADFDPAFVEACQDATAEITATLSTADQ------------EARITGRGHPGLSFENDRSL
23420|hp|hbo      PEDFDDDFVAACQDESATITAIVEVEDDDGE-------TYQQTVEGSGHPDLTFEGDRSH
11816|hp|hma      PADFDSEFVTACQDADATITATIEAGEQ------------TVTVTGTGHPDLSFENDRSH
2342|hp|hhi       PADFDSEFVTACQDADATITATIEAGEQ------------TVTVTGTGHPDLSFENDRSH
                  *  *.  *  ***.  * **  . . .                : * * * *:: .:** 

781|gene|hla      VGRTSDYTDDERTIFVDGDGAAADLDRDLVAALAADAPVTLRLEVDPAE-
1529|hp|hwa       VARTSTYTDD-RTVLVDGDTAAADIDRDMIDALTTGAKLTLELSVTIQAD
396|chp|nrc1      VGRTSTYVDD-RTVFVDADKAAADVDRELVAALADGAPLTATLRVD----
4060|hp|nph       VGRTSDYVDD-RTVMVGASAAAADIDRAIADRLADGADIECRLAVDP---
2703|hp|hut       VIRTSEYVDD-RTVMIDADAAAADLDRELVDALAAGASVTMRLTVE----
23420|hp|hbo      VGRTSDYVDD-RTILVGADAAAGDFDRDLVAALANGGDVTFTLRVE----
11816|hp|hma      VLRTSDYVDD-RTVMVNADTAAGDVDRDLVEALADGHDATLTLSVEPSGD
2342|hp|hhi       VLRTSDYVDD-RTVMVNADTAAGDVDRDLVEALADGHDATLTLSVEPSGD
                  * *** *.** **:::... **.*.** :   *: .      * *