HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0650COG1736KOG2648arCOG04112Diphthamide synthase subunit DPH2hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0650 nrc1 VNG0854 vng854 no entry
cHOG0650 hmu HMUK2492 Hmuk_2492 diphthamide biosynthesis protein
cHOG0650 hma RRNAC0405 hypothetical protein
cHOG0650 hwa HQ2590A dph2 diphthamide synthase subunit DPH2
cHOG0650 hla HLAC0813 Hlac_813 diphthamide biosynthesis protein
cHOG0650 hbo HBOR15900 Hbor_15900 protein with diphthamide biosynthesis protein 2- related domain
cHOG0650 hut HUTA2799 Huta_2799 diphthamide biosynthesis protein
cHOG0650 hvo HVO_1631 HVO_1631 dph Diphthamide synthase subunit
cHOG0650 nph NP3154A hypothetical protein
cHOG0650 hhi 1224 dph2 diphthamide biosynthesis protein
MUSCLE (3.6) multiple sequence alignment


2799|gene|hut       --MSQESERSPGDLTATGMALRHDREWDYELDRISEAVEERNANSVGLQFPEGLKRRGPA
854|chp|nrc1        --MSNEEARSAGDLRNTGLSLRHDRTWDYELDRIVDEVERKDAEKVGLQFPEGLKRRGPA
3154|hp|nph         MSQQPESDRTEGDLRNTGMELKHERTWDYELDRIVDAVEERDAMKVGLQFPEGLKRRAGR
10405|hp|hma        ----MSQERTDGDLRNTGLSLKHDREWDYELDRIVEAVEERDAEKVGLQFPEGLKRRGPA
1224|gene|hhi       ----MSQERTDGDLRNTGLSLKHDREWDYELDRIVEAVEERDAEKVGLQFPEGLKRRGPA
813|gene|hla        -----MSDSTEGDLTKTGMALKHDREWDYELDRIVEAIEERDASKVGLQFPEGLKRRGPK
2590|gene|hwa       -MIMSQETATEGDLRNTGMSLKHDREWDYELDRIVEEIEERDADRVGLQFPEGLKRRGPA
15900|gene|hbo      ------------------MSLKHDREWDYELERIVEEVEDRDAKRVGLQFPEGLKRRGPA
                                      : *.*:* *****:** : :* .:*  ************.  

2799|gene|hut       VADDLRRTLPDDVTVMLSGEPCYGACDLDTELMRHSEVFVHFGHSPMNESEQIIYVPLFS
854|chp|nrc1        VADDLRARL-DDTRIMLSGQPCYGACDLDTYLMRRTDVFVHFGHSPMKESDSIIYVPLFS
3154|hp|nph         VADDLRRLLPDETTVLLSGQPCYGACDLDTYMMRRTDVFVHFGHSPMKESDKIIYVPLFS
10405|hp|hma        VADDLREELPDDVTVLLSGQPCYGACDLDTYMMRRTDVFVHFGHSPMKESDKIIYVPLFS
1224|gene|hhi       VADDLRENLPDDVTVLLSGQPCYGACDLDTYMMRRTDVFVHFGHSPMKESDKIIYVPLFS
813|gene|hla        VADDLREVAPDDVTFMLSGQPCYGACDLDTYLMRRTDVFVHFGHTPMKESDSIVYVPLFS
2590|gene|hwa       VADDLRALCGDDVTFMLSGQPCYGACDLDTYLMRRTDVFVHFGHSPMKESDKIIYVPLFS
15900|gene|hbo      VADDLRERCDDDVTFMLSGQPCYGACDLDTYLMRRTDVFVHFGHSPMKESDKIIYVPLFS
                    ******    *:. .:***:********** :**.::*******:**:**:.*:******

2799|gene|hut       NVDVFPIMEESLAE-FEDPEEDEDIGLVTTAQHMNKFEEMREFLEERGYTVHTRRGDERL
854|chp|nrc1        NVDVEPIMQEARDE-----LHDGDVGLVTTAQHMNQFEEMRTWLEERGYTVHTRRGDDRL
3154|hp|nph         NVEVTPIMEEARAE-LAAPEEDDAVGLVTTAQHMNRFDEMQAWLEERGYTVETRRGDERL
10405|hp|hma        NVDVFPIMEQAREEQLADPEDDPDVGLVTTAQHMNKFDEMREWLEERGYTVHTRRGDERL
1224|gene|hhi       NVDVFPIMEQAREEQLADPEEDPDVGLVTTAQHMNKFDEMREWLEERGYTVHTRRGDERL
813|gene|hla        NVDPFPIMEDALEEELASPEEDADVGLVTTAQHMNRFEEMTDWLEERGYEVHTRRGDDRL
2590|gene|hwa       NVDPFPILEEAVDE-----LPEDDVGLVTTAQHMNQFESMVTWLETRGFDVHTRRGDDRL
15900|gene|hbo      NVDPFPILEDSLAE-----LDGDEVGLVTTAQHMNRFEDMCDWLEERGYDVHTRRGDDRL
                    **:  **::::  *          :**********.*:.*  :** **: * *****:**

2799|gene|hut       THEGQVLGCNYASADVEADQMLYVGGGKFHPLGLAMDHPEKRVVIADPVNNVVDIADADA
854|chp|nrc1        TNEGQVLGCNYASADIDADQVLYVGGGKFHPLGLAMEHPEKNVVIADPVNNAVSIADAEQ
3154|hp|nph         THEGQVLGCNYASADVDADQILYVGGGKFHPLGLAMEHPDKKVIIADPVNNAVHVADTEQ
10405|hp|hma        THEGQVLGCNYASADVDADQMLYVGGGKFHPLGLAMEHPEKHVVIADPVNNVVTVADTEK
1224|gene|hhi       THEGQVLGCNYASADVDADQMLYVGGGKFHPLGLAMEHPEKHVVIADPVNNVVTVADTEK
813|gene|hla        TKEGQVLGCNYASADIDAEQVLYVGGGKFHPVGLAMEHPDKRVVIADPVNNAVSVAEHDQ
2590|gene|hwa       THEGQVLGCNYASADIDANQVLYVGGGKFHPLGLAMEHPDKHVLIADPVNNVVTVADTEK
15900|gene|hbo      TFEGQVLGCNYASADIDADQVLYVGGGKFHPLGLAMEHPDKKVVIADPVNNVVTIADTEK
                    * *************::*:*:**********:****:**:*.*:*******.* :*: : 

2799|gene|hut       LIKQRYGAIHRAMDAETWGIIYSTKIGQGRLERARQIVEDNDDAYLLTMNNVTPQKLTNF
854|chp|nrc1        FLKERYASVHKAMDAEQWGVIFCTKIGQGRFDQAEEIVENNDNAYLITMDEVTPDRLMNF
3154|hp|nph         FMKQRYAAVHKAMDAEEWGVIFCTKIGQGRWDTAEEIVEANDNAYLITMDEVTPDRLTNF
10405|hp|hma        FMKQRYGAVHRAMDAESWGVIFCTKIGQGRWDQAEEIVENNENAYLITMDEVTPDRLTNF
1224|gene|hhi       FMKQRYGAVHRAMDAESWGVIFCTKIGQGRWDKAQEIVENNENAYLITMDEVTPDRLTNF
813|gene|hla        FLKQRYASVHKAMSAEKWGVIFCTKIGQGRWEKAQEIVENNENAYLITMDEVTPDRLRNF
2590|gene|hwa       FMKQRYAAVHKAMSANKWGVIFCTKIGQGRMDTAESILEDNDNTYLITMDEVTPDRLRNF
15900|gene|hbo      FMKQRYASVHKAMDAEKWGVIFCTKIGQGRMEIAEKIIEDNDNAYLITMDEVTPDRLRNF
                    ::*:**.::*.**.*: **:*:.******* : * .*:* *:::**:**::***:.* **

2799|gene|hut       GLDAYVNTACPRITTDDGPQFKQPMLTPGEYEIAMGEKPMDSLSFDTFHGTW
854|chp|nrc1        DMDAFVNTGCPRITTDDGPQFHKPMLTPGEYEIAVGNKPLEDLSFDTFHGTW
3154|hp|nph         GFDAYVNTGCPRITTDDGPQFKQPMLTPGEYKIAIGEKPMDSLSFDTFHGTW
10405|hp|hma        GMDAYVNTGCPRITTDDGPQFKKPMLTPGEYEIAIGEKPLDSLEFDTFHGTW
1224|gene|hhi       GMDAYVNTGCPRITTDDGPQFKKPMLTPGEYEIAIGEKPLESLEFDTFHGTW
813|gene|hla        DMDAFVNTGCPRITTDDGPRFHKPMLTPGEYEAAIGEKPLDSIEFDTFHDTW
2590|gene|hwa       DMDAFVNTGCPRITTDDGPQFHKPMLTPGEYRIAVGDKPLDSLSFDTFHGTW
15900|gene|hbo      DMDAFVNTGCPRITTDDGPRFHKPMLTPQEYRIAVGDEPLDSLEFDTFHGTW
                    .:**:***.**********.*::***** **  *:*::*::.:.*****.**