HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0648arCOG04635hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0648 nrc1 VNG1329 vng1329 no entry
tucHOG0648 hmu HMUK2543 Hmuk_2543 conserved hypothetical protein
tucHOG0648 hma RRNAC1115 hypothetical protein
tucHOG0648 hwa HQ2458A hypothetical protein
tucHOG0648 hla HLAC1649 Hlac_1649 hypothetical protein
tucHOG0648 hbo HBOR14420 Hbor_14420 hypothetical protein
tucHOG0648 hut HUTA2882 Huta_2882 conserved hypothetical protein
tucHOG0648 hvo HVO_2915 HVO_2915 conserved hypothetical protein
tucHOG0648 nph NP4036A hypothetical protein
tucHOG0648 hhi 1722 HAH_1722 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


11115|hp|hma      MGSAQFEGFTHSLGIPAGMPVDKQEFDEILSFELHEPADILDPDKLYTIPEIARLLQGLP
1722|hp|hhi       ------------------MPVDKQEFDEILSFELHEPADILDADKLYTIPEIARLLQGLP
2458|hp|hwa       ------------------MPRPKDAFETLYPYQLYKPAEILDAELMYTVDEIARLLQGLD
14420|hp|hbo      ------------------MPRPKTEFETLYPYQLYEPEEVLDDELMYTVPEIARLLQGLD
2882|chp|hut      ------------------MPRPRSDFDDLRPLEFRDPEEVLAADRMYTIYEIARLLQGVD
4036|hp|nph       ------------------MPRPRSSFDDLRSFEFRDPEEVLDADKLYTVYEIARLLQGLD
1649|hp|hla       ------------------MPEPKSTFDATYPCDFYEPAELFESDQMYTIPEIARLLQELD
1329|hp|nrc1      ------------------MPVAKSEFDDLYPCDFYEPAALLDDDRMYTVYEIARLLQDLE
                                    **  .  *:   . :: .*  ::  : :**: ******* : 

11115|hp|hma      ADAQLNEANESVFIDWAIPWMIFNQDDLVIADPQDDDVVGLYGLAES-------------
1722|hp|hhi       ADAELSEASESVFIDWAIPWMIFNQDDLVIADPQDDDVVGLYGLAES-------------
2458|hp|hwa       PGADLPSETEERVVAWTIPWLMAHADELVINDPVGDE-PGYFGLRRETKTAS-VPDDADT
14420|hp|hbo      PATELDAETEDQVVTWTIPWLMAHADELVINDPEGDE-PGYFGIQSESRPADEIPDGADE
2882|chp|hut      PDAELDVETENVLLDWAIPWVLNHADAFVFAEPSGDTEPGYYGLAADS------------
4036|hp|nph       PDADLDPGTEGILLDWAIPWMLDHSDAFVFAEPEADEEPGYYGLK---------------
1649|hp|hla       PDAEIDPDTEAVLIDWAIPWVMTHAEDLVIAEPLAEDGPGYYGVAPHAIDGEKGAGEGDT
1329|hp|nrc1      PDADIDRGTEDVLLDWAIPWVMLHAGALVVAEPRTDDEPGYYGLDTS-------------
                  . :::   .*  .: *:***:: :   :*. :*  :   * :*:                

11115|hp|hma      ------
1722|hp|hhi       ------
2458|hp|hwa       ------
14420|hp|hbo      ------
2882|chp|hut      ------
4036|hp|nph       ------
1649|hp|hla       DLQDGA
1329|hp|nrc1      ------