HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0645arCOG04717hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0645 nrc1 VNG2656 vng2656 no entry
tucHOG0645 hmu HMUK0505 Hmuk_0505 conserved hypothetical protein
tucHOG0645 hma RRNAC2415 hypothetical protein
tucHOG0645 hwa HQ3389A hypothetical protein
tucHOG0645 hla HLAC0408 Hlac_408 hypothetical protein
tucHOG0645 hbo HBOR28150 Hbor_28150 hypothetical protein
tucHOG0645 hut HUTA2873 Huta_2873 conserved hypothetical protein
tucHOG0645 hvo HVO_0355 HVO_0355 conserved hypothetical protein
tucHOG0645 nph NP0128A hypothetical protein
tucHOG0645 hhi 2848 HAH_2848 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2656|hp|nrc1      MEIRVSGAGPAAPFFSARDVFEPSHDLDLPVDVHIRSNPDERTWAGHYDDHHVLNISQQA
2873|chp|hut      MDLQFDGTGPTAPFLGARDLFRTEHDLDRPVTVRITSEPDERTRVSHDADGHQLTISRHA
12415|hp|hma      MDVHVQG-GPAEPFLGARDLFSTEHDLKRPVTVRVREDPDERTRVSHSDDAHRLTISRQA
2848|hp|hhi       ----MQG-GPAEPFLGARDLFSTEHDLNRPVTVRIREDPDERTRVSHSDDAHRLTISRQA
128|hp|nph        MDIRVRGDGPAAPFLSARDMLDTEYGLERPVVVDIRDDPDERTMVGHYDDRHELVVSRRA
3389|hp|hwa       MDVRVRGAAPAEPFLGAAELFETEYDLNSPVYVDVRENPDERTWAAHYEDRHVLNISQKA
408|hp|hla        MDLRVQGDVPPDPFLGAADLFETEWSLDDPVHVKVREDPDERTWAGHYDGYHVLNVSKRA
28150|hp|hbo      MDLRVLGSAPTDPFLSAADLFETEYDLDKPVHVTVRDDPDERTWAAHYDDRHELNISRQA
                      . *  *. **:.* ::: .. .*. ** * : .:***** ..*  . * * :*..*

2656|hp|nrc1      ATSVMARELALHEFAHMHRHERGHPSHTLSMDEVLFLALTGREVEQRVLTHCYQIANHVK
2873|chp|hut      ATSALAREIILHEFAHMHHAERGHPSHSLSTEEVLFLALSGRSVERRTVTQCYQIANHAR
12415|hp|hma      ATSAMARELALHEYAHMHHHECGHPSHTQSTREAIYLALAGRSVEQRKLTHCYQIANHMK
2848|hp|hhi       ATSAMARELALHEYAHMHHHEREHPSHTQSTREAIYLALAGRSVEQRKLTHCYQIANHMK
128|hp|nph        ATSAMARELALHEFAHMARYEQAHPSHLQSTEEALFLALAGRSVEQRKLSHCYQIANHMK
3389|hp|hwa       ATSAMARELVVHELAHMARNEEGHVSHHLATEEALYLALAGESIERHKIAHCYQIANHMK
408|hp|hla        ATSAMARELAVHELSHMARYEEGHASHVQSTEEALYLGLSGETVERRKLAHCYQIANHMK
28150|hp|hbo      ATSAMGRELVLHELAHMVRYEEQHASHIQSTEEALYLALSGKSVERRKLAHCYQIANHMK
                  ***.:.**: :** :** . *  * **  :  *.::*.*:*  :*.. :::******* .

2656|hp|nrc1      DIYADDITLSVGPTDKLRSFLESELAAAI--ADQPAD--RQQAGH-------------RL
2873|chp|hut      DIYADDVWIDVAPAAKLVDFLEAGVAAAV--ADRQPDSVTWE----------------RV
12415|hp|hma      DVYADDIWMPVVPGDKLVPFLEASLAAAV--ADRPGDPPTWDRSTSSTRVRQPSEPAARL
2848|hp|hhi       DVYADDIWMPVVPGDKLVPFLEASLAAAV--ADRPGDPPTWDRSTSPTRVRHPSEPAARL
128|hp|nph        DIYADDITLDIGPTDKLVSFLESSLARAL--ADSPPSPP--EDGR-------------RL
3389|hp|hwa       DIYADDITLAVTAPTKLIDFLESELARAVASASAPALSP-RPNSR-------------RV
408|hp|hla        DIYADDITLSVAPADKLLGFLESTLAAAV--ADRPEVSR--DGAP-------------PV
28150|hp|hbo      DIYADDITLSLGLAEKLVHFLESELARAI--AANPGPSP-WPNSR-------------LV
                  *:****: : :    **  ***: :* *:  *                           :

2656|hp|nrc1      TAGADPSMTAVNAAFALALLERHDAIPGDHRLYDLAHAAGQDAPEIDVDGFRRRFATLGP
2873|chp|hut      SATSDPDITAVNAAFALALVERHGLVGDDHRLYDLAYAAETDAPHIGFDEFRERFRSLSR
12415|hp|hma      TPAADPDITAVNAAFALALCERHDLVETDHRLYDLAHAAAQDAESVDLTEFKRHFAALSP
2848|hp|hhi       TPAADPDITAVNAAFALALCERHDLVEPDHRLYDLAHAAAQDAESVDLTEFKRHFGSLSP
128|hp|nph        RPGADPEITVVNAAFALALLERHDAIDADHRLYDLASAAAADAPSVSLSAFKRRFRSLED
3389|hp|hwa       TVDADPEITAVNAAFALALVERHDLISADHRLYDLAHAAADDAPTIDMKAFTQHFRSLEA
408|hp|hla        TAGADPEITAVNAAFALALVERHDIAGPNHRIYDLARAAGSDTDAVDVDAFKERFLALGP
28150|hp|hbo      TANADPEITAVNAAFALALVERHGLIDPDHRIYDLAHAAADDAPDVELSAFKERFRSLSD
                     :**.:*.********* ***.    :**:**** **  *:  : .  *  .* :*  

2656|hp|nrc1      DPDESDCRRGLVDTIRTYADAQTTTTGPAAD-----------------------------
2873|chp|hut      DPTESEFRAELVDLVRTYA-SRTTRVAD--------------------------------
12415|hp|hma      EPDESEFRKALVDVTRAYA-GGGSRAAD--------------------------------
2848|hp|hhi       EPNESEFRKALVDVTRAYA-GGGGRAAD--------------------------------
128|hp|nph        DPDESAYRKALVDATREYVLSDTGQAAD--------------------------------
3389|hp|hwa       NPTTSEYRSELVDATRAYALGESGLAQSETADEEQKCGQRIDSNKTLTPQSQSQSRSQSQ
408|hp|hla        DPSESDYRKALVAAARAYAV----------------------------------------
28150|hp|hbo      DPTESDYRKALVDVTREYAIGTNDRGGPAAAD----------------------------
                  :*  *  *  **   * *.                                         

2656|hp|nrc1      --------
2873|chp|hut      --------
12415|hp|hma      --------
2848|hp|hhi       --------
128|hp|nph        --------
3389|hp|hwa       FQFGPASD
408|hp|hla        --------
28150|hp|hbo      --------