HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0644COG0136KOG4777arCOG00494Aspartate-semialdehyde dehydrogenaseaspartate-semialdehyde dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0644 nrc1 VNG1435 asd aspartate-semialdehyde dehydrogenase
cHOG0644 hmu HMUK2563 Hmuk_2563 aspartate-semialdehyde dehydrogenase( EC:1.2.1.11 )
cHOG0644 hma RRNAC0365 asd aspartate-semialdehyde dehydrogenase
cHOG0644 hwa HQ2908A asd aspartate-semialdehyde dehydrogenase
cHOG0644 hla HLAC1745 Hlac_1745 aspartate-semialdehyde dehydrogenase
cHOG0644 hbo HBOR11210 Hbor_11210 aspartate semialdehyde dehydrogenase( EC:1.2.1.11 )
cHOG0644 hut HUTA0768 Huta_0768 aspartate-semialdehyde dehydrogenase
cHOG0644 hvo HVO_2487 HVO_2487 asd aspartate-semialdehyde dehydrogenase
cHOG0644 nph NP1988A asd aspartate-semialdehyde dehydrogenase
cHOG0644 hhi 1095 asd aspartate-semialdehyde dehydrogenase
MUSCLE (3.6) multiple sequence alignment


1435|gene|nrc1      ----------MTTVGVLGATGAVGQRFVQLLAGHETFELSVVTASPDSAGETYRDAANWG
768|gene|hut        ---------MPVTVGILGATGAVGQRLVQLLDPHPDFEIAALTASENSAGTSYREAAKWR
2908|gene|hwa       ---------MTVRVGILGATGAVGQRFIKLLTNHDTFELAALTASESSVGKQYSNAAKWR
1745|gene|hla       ---------MSVRVGILGATGAVGQRFIQLLDDHPTFDLAAVTASADSAGKTYREAAKWR
11210|gene|hbo      MGVPRKNTAMTVQVGILGATGAVGQRFIQLLDGHPTFELAALTASEASAGKTYAEAAKWR
1988|gene|nph       --------MSTTRVGVLGATGAVGQRLIQLLDPHEEFEVAALSASSASAGKTYREAAKWR
10365|gene|hma      ---------MTVRVGVLGATGAVGQRLIQLLDPHPEFEIAALTASDASVGETYKDAAKWR
1095|gene|hhi       ---------------MLGATGAVGQRLIQLLDPHSEFEIAALTASDASVGETYKDAAKWR
                                   :**********:::**  *  *:::.::**  *.*  * :**:* 

1435|gene|nrc1      LDTPVPESIAELPVQPTTPAAIPD-DTALLFSALPSDVGAEVEPALCEAGFVVSSNASNE
768|gene|hut        IDTPIPDHIGEMTVRATEPAAVPD-DIDLLFSSLPSAVGEAVEPDFAEAGYVVSSNSSNF
2908|gene|hwa       INTPIPENIGSMTVKSTTPDAISD-DIDLLFSSLPSDVAADVEPAFLEAGYVVSSNSSND
1745|gene|hla       VDTPIPDDVAEMEVTETTPAGIADADVDLLFSSLPSGVASEVEPAFLEEGYVVSSNSSND
11210|gene|hbo      VNTPIPDDVAEMKVTATTPEAVPN-DVDLLFSSLPSGVATEIEPEFLHEGYVVSSNSSND
1988|gene|nph       VDTPIPESVADMTVVETDPDAVPD-DIDLLFSSLPSDIGADVEPEFVEAGYVVSSNSSNG
10365|gene|hma      VNSPIPEDVAGLEVRATDPDSVPD-DVGLIFSSLPSSVGAEVEPEFCEAGYTVSSNSSNA
1095|gene|hhi       VDSPIPEDVAGLEVRATDPDSVPD-DVDLIFSSLPSSVGAEVEPEFCEAGYTVSSNSSNG
                    :::*:*: :. : *  * * .:.: *  *:**:*** :.  :** :   *:.****:** 

1435|gene|nrc1      RRAGDVPLVVPEVNADHLGLIDVQRDARGWDGALVKNPNCSTITMVPTLAALT-EFGLDR
768|gene|hut        RTDPDVPLTIPEVNPDHVELLDVQRDQRGWDGALLKNPNCSTITMVPPLAALDEAFGVER
2908|gene|hwa       RMSADIPLTIPEINPGHLDLIEVQRDNRGWDGALVKNPNCSTITMVPTLAALD-QFGLET
1745|gene|hla       RMAADVPLTIPEINPGHLDLIEVQRDERGWDGALVKNPNCSTITMVPTLAAID-EFGLES
11210|gene|hbo      RMAPDVPLTIPEINPGHLDLIEVQRDERGWDGALVKNPNCSTITMVPTLAALD-QFGLES
1988|gene|nph       RMDDDIPLTIPEVNADHLGLIEVQRDERGWDGALIKNPNCSTITMVPALAALD-EFGLEN
10365|gene|hma      RMDEDVPLIIPEVNADHVDLLEVQRDERGWDGALLKNPNCSTITMVPPLAALDREFDLTD
1095|gene|hhi       RMDEDVPLIIPEVNADHVDLLEVQRDERGWDGALLKNPNCSTITMVPPLATLDREFDLTD
                    *   *:** :**:*..*: *::**** *******:************.**::   *.:  

1435|gene|nrc1      VHVATLQAVSGAGYSGVTSMEILDNVVPHIGGEERKMETESRKLLGEFTGAEVQHHDAVV
768|gene|hut        VDVSTLQAVSGAGYSGVTSMEIIDNAIPHIGGEETKMETESRKLLGEFDGSEVEWLDADV
2908|gene|hwa       VSVSTLQAVSGAGYSGVTSMEIIDNTIPYIGGEEPKMQQESRKLLGEFDGASVSLHEMDV
1745|gene|hla       VRVSTLQAVSGAGYSGVTSMEIIDNAIPHIGGEEEKMETESRKLLGEFDGAEVHLHGADV
11210|gene|hbo      VHVSTLQAVSGAGYSGVTSMEIIDNAIPHIGGEENKMETESRKLLGEFDGTDVSLHEMDV
1988|gene|nph       IHVSTLQAVSGAGYSGVTSMEIIDNVIPHIGGEAEKMETESRKLLGSFDGAGVDLHEADV
10365|gene|hma      VRVSTLQAVSGAGYSGVTSMEIIDNAIPHIGGEEQKMESESRKLLGSFDGAEVQLNEMDV
1095|gene|hhi       VRVSTLQAVSGAGYSGVSSMEIIDNAIPHIGGEEQKMETESRKLLGSFDGAEVHLNEMDV
                    : *:*************:****:**.:*:****  **: *******.* *: *      *

1435|gene|nrc1      SASCNRVPTLDGHLENVFVETSDHPAPADVAAAFEDAPT-LDLPSAPDPLIETF--TAPE
768|gene|hut        AASCNRIPTLDGHLENVWADLDGDVSVEEAAEAMAAYPS-ADLHSSPGPLIKVF--DEPD
2908|gene|hwa       AASCNRIPTLDGHLENVFAETTADVSAEEAIDAMESVPG-ADLPSSPDQLIHVF--DDPS
1745|gene|hla       AASCNRIPTLDGHLENVFAEFAEDPSPADLREAMRSFEGAAALPSSPDQLIKVFGEDEPE
11210|gene|hbo      AASCNRIPTLDGHLENVFAETAEDVTPDEAAEAMREYSG-VDLHSAPDQLIHVF--EDPA
1988|gene|nph       SASCNRVPTLDGHLENVWADLAADPDPADVVEAFESYPS-VDLPSSPDQLIEVF--DEPD
10365|gene|hma      AASCNRIPTLDGHLENVWADTAEDISAADAEAAMESVTG-IDLPSSPEKLITVF--EEPD
1095|gene|hhi       AASCNRIPTLDGHLENVWADTTEDISTADAEAAMESATG-IDLPSSPEKLITVF--EEPD
                    :*****:**********:.:        :   *:        * *:*  ** .*    * 

1435|gene|nrc1      RPQPRLDRMRGDGMAIAAGGIQTTDTGIQYNCLAHNTIRGAAGASILNGELLAREGWV
768|gene|hut        RPQPRLDRNREDGMQISVGGIQETETGIQFNTLAHNTLRGAAGASILNGELLVEKGYV
2908|gene|hwa       RPQPRLDRERGNGMQISAGGVTVTDAGLKYNCLAHNTIRGAAGASLLNGELLVDAGWV
1745|gene|hla       RPQPRLDRTYAGGMGIVAGGVQATNAGMKYNCLAHNTIRGAAGASLLNGELLVEEGYV
11210|gene|hbo      RPQPRLDRERGDGMQICAGGLHETANGLKYNCLAHNTIRGAAGASLLNGELLVEEGWV
1988|gene|nph       RPQPRMDRMLGDGMAIATGGVESTADGIQFNCLAHNTMRGAAGASVLNGELLLEEGYL
10365|gene|hma      RPQPRLDRNVEDGMGVAVGGFRETTDGVQFNCLAHNTMRGAAGASVLNGELLNKRGYL
1095|gene|hhi       RPQPRLDRNVEDGMGVAVGGFRETTDGVQFNCLAHNTMRGAAGASVLNGELLNKRGYL
                    *****:**   .** : .**.  *  *:::* *****:*******:******   *::