HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0643COG0114KOG1317arCOG01749Fumarasefumarate hydratase

HOG Organism Gene ID Name Annotation
cHOG0643 nrc1 VNG1356 fumC fumarate hydratase
cHOG0643 hmu HMUK2778 Hmuk_2778 fumarate lyase( EC:4.2.1.2 )
cHOG0643 hma RRNAC0028 fumC fumarate hydratase
cHOG0643 hwa HQ2471A fumC fumarate hydratase
cHOG0643 hla HLAC2205 Hlac_2205 fumarate lyase
cHOG0643 hbo HBOR14250 Hbor_14250 fumarase( EC:4.2.1.2 )
cHOG0643 hut HUTA2660 Huta_2660 fumarate lyase
cHOG0643 hvo HVO_2900 HVO_2900 Fumarate hydratase class II
cHOG0643 nph NP3778A fumC fumarate hydratase
cHOG0643 hhi 789 fumC fumarate hydratase, class II
MUSCLE (3.6) multiple sequence alignment


2471|gene|hwa       -------MADDYRVERDSLGEIQVPADAYWGAQTQRAIENFPLSGITFGRRFIRALGIVK
2660|gene|hut       MTDSRDYGNEDYRIEADSLGEMEVPADAYWGAQTQRAIENFPISDQRFGRRFIRALGVVK
3778|gene|nph       -MPPMADEDTDYRIERDSLGEMEVPADAYWGAQTQRALGNFPVSGITFQRRFIRALGIVK
10028|gene|hma      -------MTDEYRTEQDSLGEMQVPADAYWGAQTQRAVENFPISDVTFGRRFIRALGVVK
789|gene|hhi        -------MTDEYRTEQDSLGEMQVPADAYWGAQTQRAVENFPISDVTFGRRFIRALGVVK
2205|gene|hla       -------MSEDYRTEEDSLGEMQVPADAYWGAQTQRAVENFPISGIPMSRRFIRALGVVK
1356|gene|nrc1      -------MSEDYRTEQDSLGEMQVPADAYWGAQTQRAIENFPISGIAFGRRFVRALGVVK
14250|gene|hbo      -------MSEDFRTERDSLGEMQVPADAYWGAQTQRAVENFPISGITFSRRFIRALGVVK
2900|gene|hvo       ------MGDDDYRIERDSLGEMEVPVDAYWGAQTQRAVENFPISGITFGRRFVRALGVVK
                              ::* * *****::**.***********: ***:*.  : ***:****:**

2471|gene|hwa       KAAAQANRDLDLIDADTADAIVAAADEVIAGEFDDQFPVDIFQTGSGTSSNMNANEVIAN
2660|gene|hut       KGAAQANRDLGLLDEEKADAIVAAADEVIAGDHDDQFPVDIFQTGSGTSTNMNANEVIAN
3778|gene|nph       KSAAKANLDLELLEADKAEAIIEAADEVIAGEHDDQFPVDVFQTGSGTSSNMNANEVIAN
10028|gene|hma      KAAAQANRDLETIPEDKADCIVEAADEVIAGEHDDQFPVDVFQTGSGTSSNMNANEVISN
789|gene|hhi        KAAAQANRDLGTIPEDKADCIVEAADEVIAGEHDDQFPVDVFQTGSGTSSNMNANEVISN
2205|gene|hla       KAAAQANRDLGLIDDDTADAIVAAADEVIAGDHDDQFPVDVFQTGSGTSSNMNANEVIAN
1356|gene|nrc1      KAAAQANRDLGLVDDERADAIVAAADEVIAGEHDDQFPVDVFQTGSGTSSNMNANEVIAN
14250|gene|hbo      KGAAQANRDLGLVEENIADAIVEAADEVIAGEHDDQFPVDVFQTGSGTSSNMNANEVIAN
2900|gene|hvo       KAAAQANRDLGMIDEGVAAAIVEAADEVIAGELDDQFPVDVFQTGSGTSSNMNANEVIAN
                    *.**:** **  :    * .*: ********: *******:********:********:*

2471|gene|hwa       RAAEILDKSIGERAVHPNDDVNFGQSSNDVIPTAMHIAADEAVTKDLLPALDTLESELAS
2660|gene|hut       RATEIVGGEIGSKKIHPNDHVNYGQSSNDVIPTAMHVAVLEAIERDVLPGLETLREELQI
3778|gene|nph       RATEIYGGEIGTREIHPNDHVNYGQSSNDVIPTAMHVASLEAARKDVLPGLETLAEELAA
10028|gene|hma      RATELYGGDIGTREIHPNDHVNFGQSSNDVIPTAMHVASLEAVEKDVIPGLKTLRDELEA
789|gene|hhi        RATELYGGDIGTREIHPNDHVNFGQSSNDVIPTAMHVASLEAVEKDVIPGLKTLRDELEA
2205|gene|hla       RAAEIAGAEIGDRVVHPNDHVNYGQSSNDVIPTAMHVAALEAVEKDLVPALETLHTELEA
1356|gene|nrc1      RAAELLGEEIGDRVVHPNDHVNYGQSSNDVIPTAMHVASLDALVNDVKPGLETLAAELDD
14250|gene|hbo      RAAELMGEEIGDRVVHPNDHVNYGQSSNDVIPTAMHVSALEAVEKDLLPALDTLREALEA
2900|gene|hvo       RAAEIMGEGIGDRVVHPNDHVNFGQSSNDVIPTAMHVASLEAVEKDLLPALETLAAALGD
                    **:*: .  ** . :**** **:*************::  :*  .*: *.*.**   *  

2471|gene|hwa       QAEAFDDVIKTGRTHLQDATPISLGQEFDGYKTQIQKGISRVETVTDHLSELALGGTAVG
2660|gene|hut       KEEEFDDVVKTGRTHLQDATPVMLGQEFSGYRTQIEKGIARVEETRERAAELALGGTAVG
3778|gene|nph       KEDEFDAVVKTGRTHLQDATPVRLGQEFGGYRTQIEKGIDRVEGATERLEELALGGTATG
10028|gene|hma      KEDEFDTVVKTGRTHLQDATPVTLGQEFSGYRTQVEKGISRVQDVHGRLSELALGGTAVG
789|gene|hhi        KEDEFENVVKTGRTHLQDATPVTLGQEFGGYRTQVEKGISRVQDTHGRLAELALGGTAVG
2205|gene|hla       KETEFDGVVKTGRTHLQDATPIRLGQEFSGYRTQTAKGIERAETVQSNLRELALGGTAVG
1356|gene|nrc1      KADAFDGVVKTGRTHLQDATPVRLGQEFGGYRTQVEKGIDRIEAVAPRLSELALGGTAVG
14250|gene|hbo      KEEEFAGVVKTGRTHLQDATPVTLGQEFGGYRTQVEKGLGRLDGVREHLSELALGGTAVG
2900|gene|hvo       KEAEFDGVVKTGRTHLQDATPVRLGQEFGGYRTQVEKGIRRVENVREHLGELALGGTAVG
                    :   *  *:************: *****.**.**  **: * : .  .  ********.*

2471|gene|hwa       TGLNTHPEFPTRATEYISTETTISFQPADSHFEAQAAHDAMSEAHGALRTVAGSLNKIAN
2660|gene|hut       TGLNTHPEFPELAAEYISEETLLTFREADNHFEAQAAHDAMSEVHGALRTVAGSLQKIAN
3778|gene|nph       TGLNTHPEFPERAAEYISEETGLSFREADNHFEAQAAHDAMSEAHGALRTVAGSMNKIAN
10028|gene|hma      TGLNTHPEFPEKAATYISEETDLNFREADNHFEAQAAHDAMSEAHGALRTVAGSLNKIAN
789|gene|hhi        TGLNTHPEFPAKAAAYISEETGLEFREADNHFEAQAAHDAMSEAHGALRTVAGSLNKIAN
2205|gene|hla       TGLNTHPDFPELAAEYISDETGTEFREADNHFEAQAAHDAMAEAHGALRTIAGSLNKMAN
1356|gene|nrc1      TGLNTHPEFPETAAGYISEETGVTFREADNHFEAQAAHDAMNEAHGALRTVAGSLNKIAN
14250|gene|hbo      TGLNTHPDFPKKAAEYITAETGVEFREADNHFEAQAAHDAMSEAHGALRTVAGSLNKIAN
2900|gene|hvo       TGLNTHPEFPAKAAEYMTEETGVEFREADNHFEAQAAHDAMSEAHGALRTVAGSLNKIAN
                    *******:**  *: *:: **   *. **.*********** *.******:***::*:**

2471|gene|hwa       DLRLLASGPRNGLGEIDQPENQPGSSIMPGKINPVIAEAVNQAHKQVVGNDAAVAAGAAE
2660|gene|hut       DLRLLASGPRNGLGELDQPENQPGSSIMPGKINPVVAESVNQAYAQVVGNDAAVSTGAAN
3778|gene|nph       DLRLLASGPRNGLGEVEQPENQPGSSIMPGKINPVVAESVNQVHKQVIGNDAAVSAGAAR
10028|gene|hma      DLRLLASGPRNGLGEIDQPENQPGSSIMPGKINPVVAEAVNQVHKQVVGNDAAVSAGAAE
789|gene|hhi        DLRLLASGPRNGLGEIDQPENQPGSSIMPGKINPVVAEAVNQVHKQVVGNDAAVSAGAAE
2205|gene|hla       DLRLLASGPRNGLGEIEQPENQPGSSIMPGKINPVVAESVNQVHKQVVGNDAAISAGAAR
1356|gene|nrc1      DLRLLASGPRNGLGEIEQPENQPGSSIMPGKINPVVAEAVNQVHKQVVGNDAAIAAGAAE
14250|gene|hbo      DLRLLASGPRNGLGEIEQPENQPGSSIMPGKINPVVAEAVNQVHKQVVGNDAAISAGAAE
2900|gene|hvo       DLRLLASGPRNGLGELEQPENQPGSSIMPGKINPVVAEAVNQVHKQVVGNDAAVSAGAAE
                    ***************::******************:**:***.: **:*****:::*** 

2471|gene|hwa       GQIDLNLYKPVIAHNFLQSAMLLSNTSTVFAERFIAKLDANEAVCETQVDQSLALVTALN
2660|gene|hut       GQIDLNLYKPVIASNVLESARLIANVSGAFATKFVAKLEADREHCEERVEQSMALATALN
3778|gene|nph       GEIDLNLYKPVLAYNFLQSASIIASSAELFGERFVGKLEANADHCRTKVEQSMALATALN
10028|gene|hma      GQIDLNLYKPVLASNFLQSAKLIANSSAVFGEKFVAKLEADADHCAERVEQSMALATALN
789|gene|hhi        GQIDLNLYKPVLASNFLQSAKLIANSSAVFGEKFVAKLEADAEHCAERVEQSMALATALN
2205|gene|hla       GEIDLNLYKPVIAHNFLESAELLSNAAATFGERFVAKLEANEEHCETRVEQSMALATALN
1356|gene|nrc1      GQIDLNLYKPVLAHNFLQSADMLANASAAFGEKFVAKLEANEAACEAQVERSMALATALN
14250|gene|hbo      GQIDLNLYKPVLAHNFLESAQLISNASETFGTKFVRKLEANEEVCEEQVERSMALATALN
2900|gene|hvo       GQIDLNLYKPVLAHNFLESAKLLANSSEVFAERFVAKLEANEEHCETRVEQSMALATALN
                    *:*********:* *.*:** :::. :  *. .*: **:*:   *  .*:.*:**.****

2471|gene|hwa       PTIGYDKASKVAKKALKEDATVRDVVIEQGYLSPAKADTVLNPETMTHRGIL-GESDDQA
2660|gene|hut       PAIGYDKASEVAKEAMKTGQTIREVAVEKGYLTEAEADEVLDPATMTERVIL-GEE----
3778|gene|nph       PAIGYDKASKVAKQALKEGKTVREVAVEEGYLTEAEADEVLDPKAMTERVIL-GDD----
10028|gene|hma      PAIGYDKASKVAKKALADEKTIREVVLEEGYLDEDEVDDVLDPEKMTKRGIL-GEE----
789|gene|hhi        PAIGYDKASKVAKKALAEEKTIREVVLEEGYLDEDEVDDVLDPEKMTKRGIL-GDE----
2205|gene|hla       PAIGYDKASKVAKTALKEGKSVREAAVDAGYLTEEEADEVLDPEAMTHRVIL-GDDD---
1356|gene|nrc1      PTIGYDKASEVAKAALKEGKTVTEVVVEKGYLSEAEAADVLDPEGMTHRGILSGDDT---
14250|gene|hbo      PTIGYDKASEVAKTALKEGKTVREVVIEKGYLSEEEADEVLDPEKMTHRGIL-GDD----
2900|gene|hvo       PAIGYDKASKVAKKALAEDKSVRQVAVDEGYLTEAEADEVLDPEKMTHRGIL-GDD----
                    *:*******:*** *:    :: :..:: ***   :.  **:*  ** * ** *:.    

2471|gene|hwa       DDDDTEDTTDEQ
2660|gene|hut       ------------
3778|gene|nph       ------------
10028|gene|hma      ------------
789|gene|hhi        ------------
2205|gene|hla       ------------
1356|gene|nrc1      ------------
14250|gene|hbo      ------------
2900|gene|hvo       ------------